SitesBLAST
Comparing RR42_RS26290 FitnessBrowser__Cup4G11:RR42_RS26290 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 73% coverage: 11:332/439 of query aligns to 74:389/534 of P53322
- K283 (≠ Q224) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
21% identity, 86% coverage: 32:407/439 of query aligns to 7:379/409 of 6e9nA
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
21% identity, 86% coverage: 32:407/439 of query aligns to 18:398/430 of P0AA76
- Y29 (= Y43) binding
- D31 (= D45) mutation to N: Loss of galactonate transport activity.
- R32 (= R46) binding
- Y64 (= Y78) binding
- E118 (= E132) mutation to Q: Loss of galactonate transport activity.
- W358 (= W367) binding
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
21% identity, 86% coverage: 32:407/439 of query aligns to 10:363/393 of 6e9oA
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
23% identity, 46% coverage: 88:287/439 of query aligns to 80:287/452 of Q5EXK5
- D82 (≠ H90) mutation to A: Loss of activity.
Sites not aligning to the query:
- 311 V→W: Loss of activity.
- 314 D→A: Loss of activity.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
26% identity, 54% coverage: 48:285/439 of query aligns to 73:283/444 of Q8NLB7
- R103 (= R91) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 57 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
Q9C0U9 Uncharacterized transporter PB1C11.03 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
22% identity, 53% coverage: 26:258/439 of query aligns to 93:323/570 of Q9C0U9
Sites not aligning to the query:
- 14 modified: Phosphoserine
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
20% identity, 85% coverage: 61:435/439 of query aligns to 102:479/495 of Q9NRA2
- K136 (= K95) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ I140) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ MV 155:156) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ LE 230:231) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ RNIAN 232:236) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G293) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P299) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (≠ V345) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
21% identity, 87% coverage: 55:435/439 of query aligns to 96:479/495 of Q8BN82
- H183 (≠ I140) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
19% identity, 90% coverage: 37:430/439 of query aligns to 79:494/582 of Q9JI12
- R88 (= R46) mutation to A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
- H128 (≠ A71) mutation to A: Greatly lowers L-glutamate transport.
- R184 (= R125) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E132) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (≠ T266) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
21% identity, 87% coverage: 55:435/439 of query aligns to 96:479/495 of Q5Q0U0
- K136 (= K95) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R125) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ L128) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G129) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E132) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (≠ A133) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (≠ Y136) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P137) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ I140) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ L143) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ RNIAN 232:236) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (= P299) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- G371 (≠ V345) mutation to V: Remains in the endoplasmic reticulum.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
19% identity, 90% coverage: 37:430/439 of query aligns to 21:436/452 of 7t3nA
Sites not aligning to the query:
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
23% identity, 60% coverage: 26:287/439 of query aligns to 25:296/448 of Q51955
- D41 (= D45) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (≠ N48) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (≠ N86) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (≠ H90) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G93) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R125) mutation to A: Abolishes 4-HBA transport.
- E144 (≠ Y145) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ Q191) mutation to A: Decrease in 4-HBA transport and chemotaxis.
Sites not aligning to the query:
- 323 D→N: Abolishes 4-HBA transport and chemotaxis.
- 328 H→A: Decrease in 4-HBA transport and chemotaxis.; H→R: Decrease in 4-HBA transport and loss of chemotaxis.
- 386 R→A: Strong decrease in 4-HBA transport.
- 398 R→A: Abolishes 4-HBA transport.
- 444 H→A: No change in 4-HBA transport and chemotaxis.
Query Sequence
>RR42_RS26290 FitnessBrowser__Cup4G11:RR42_RS26290
MTTAPSLAPEPAAAHAAARENAVYRKVAWRLLPFLMLCYVVAYLDRVNVGFAKLHMLGDL
QFSESAYGLGAGLFFIGYFFFEVPSNVLMHRIGAKATISRIMIMWSVISAAMVFVQTTTQ
FYVLRFLLGAAEAGFYPGMILYLTYWFPSHRRARMVALFMCAIPVSGIFGGPLSGFIMES
MQGVAGLRGWQWMFLIEALPSLLVGVAVLAYLDNSIRSARWLTQSEKDLLERNIANENAT
KGGHMTMRQLFSDRRIIKMACICFCTVMGQYGLTFWLPSLIRQAGVSGALHIGLLTAIPF
SVAVCSMILVSRSSDRMRERRWHLIVPFCCGAAGLALSAIFSDNVVLSLAALALAAGGSL
ATSPLFWSLPTALLSGAGAAAGIAMINSFANLAGFVSPYMIGLIKDATQSTNLAMFVLAG
VLLCGAALTYTVPARLVNK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory