SitesBLAST
Comparing RR42_RS26425 FitnessBrowser__Cup4G11:RR42_RS26425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7c8zA Crystal structure of salicylate 5-hydroxylase naggh (a rieske non-heme iron-dependent monooxgenase) (see paper)
44% identity, 95% coverage: 23:428/429 of query aligns to 8:382/383 of 7c8zA
- active site: H106 (= H121), D213 (= D224), H216 (= H227), H221 (= H232), D330 (= D376)
- binding fe (iii) ion: H216 (= H227), H221 (= H232), D330 (= D376)
- binding fe2/s2 (inorganic) cluster: C83 (= C98), H85 (= H100), C103 (= C118), H106 (= H121), W108 (= W123)
7q05E Crystal structure of tpado in complex with tpa (see paper)
37% identity, 95% coverage: 23:428/429 of query aligns to 5:391/409 of 7q05E
- binding fe2/s2 (inorganic) cluster: C80 (= C98), H82 (= H100), R83 (= R101), C100 (= C118), Y102 (= Y120), H103 (= H121), W105 (= W123)
- binding terephthalic acid: V203 (≠ L222), A209 (= A228), S241 (≠ T260), L271 (≠ V308), I273 (≠ M310), R292 (= R329), D339 (= D376)
7q06D Crystal structure of tpado in complex with 2-oh-tpa (see paper)
37% identity, 95% coverage: 23:428/429 of query aligns to 5:386/389 of 7q06D
- binding 2-Hydroxyterephthalic acid: V203 (≠ L222), S206 (≠ P225), A209 (= A228), F216 (≠ L235), N222 (≠ L241), S241 (= S283), I268 (≠ M310), R287 (= R329)
- binding fe (iii) ion: H208 (= H227), H213 (= H232), D334 (= D376)
- binding fe2/s2 (inorganic) cluster: C80 (= C98), H82 (= H100), R83 (= R101), C100 (= C118), Y102 (= Y120), H103 (= H121), W105 (= W123)
7vjuA Crystal structure of terephthalate dioxygenase from comamonas testosteroni kf1 (see paper)
36% identity, 95% coverage: 23:428/429 of query aligns to 4:375/378 of 7vjuA
7q04D Crystal structure of tpado in a substrate-free state (see paper)
35% identity, 95% coverage: 23:428/429 of query aligns to 4:372/374 of 7q04D
Q53122 Biphenyl 2,3-dioxygenase subunit alpha; Biphenyl dioxygenase system, oxygenase component subunit alpha; BDO, oxygenase component subunit alpha; Rieske dioxygenase; Terminal oxygenase component of biphenyl dioxygenase, large subunit; EC 1.14.12.18 from Rhodococcus jostii (strain RHA1) (see paper)
30% identity, 98% coverage: 6:427/429 of query aligns to 9:439/460 of Q53122
- C98 (= C98) binding
- H100 (= H100) binding
- C118 (= C118) binding
- H121 (= H121) binding
- 217:230 (vs. 221:233, 29% identical) binding
- H224 (= H227) binding
- H230 (≠ S233) binding
- D378 (= D376) binding
1uliC Biphenyl dioxygenase (bpha1a2) derived from rhodococcus sp. Strain rha1 (see paper)
31% identity, 91% coverage: 36:427/429 of query aligns to 21:411/425 of 1uliC
- active site: H105 (= H121), D205 (= D224), H208 (= H227), H214 (= H232), D350 (= D376)
- binding fe (ii) ion: H208 (= H227), H214 (= H232), D350 (= D376)
- binding fe2/s2 (inorganic) cluster: C82 (= C98), H84 (= H100), R85 (= R101), C102 (= C118), Y104 (= Y120), H105 (= H121), W107 (= W123)
1uljA Biphenyl dioxygenase (bpha1a2) in complex with the substrate (see paper)
31% identity, 91% coverage: 36:427/429 of query aligns to 21:413/425 of 1uljA
- active site: H105 (= H121), D205 (= D224), H208 (= H227), H214 (= H232), D352 (= D376)
- binding biphenyl: Q201 (≠ N221), F202 (≠ L222), D205 (= D224), M206 (≠ P225), H208 (= H227), A209 (= A228), H214 (= H232), I252 (≠ V273), H287 (≠ M310), L297 (≠ Q320), F342 (≠ M366)
- binding fe (ii) ion: Q201 (≠ N221), H208 (= H227), H214 (= H232), D352 (= D376)
- binding fe2/s2 (inorganic) cluster: C82 (= C98), H84 (= H100), R85 (= R101), M87 (≠ A103), C102 (= C118), Y104 (= Y120), H105 (= H121), W107 (= W123)
5aeuA Crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 (see paper)
28% identity, 91% coverage: 36:427/429 of query aligns to 22:423/433 of 5aeuA
- active site: H106 (= H121), D204 (= D224), H207 (= H227), H213 (≠ S233), D362 (= D376)
- binding fe (ii) ion: H207 (= H227), H213 (≠ S233), D362 (= D376)
- binding fe2/s2 (inorganic) cluster: C83 (= C98), H85 (= H100), R86 (= R101), M88 (≠ A103), C103 (= C118), Y105 (= Y120), H106 (= H121), W108 (= W123)
2xshA Crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl (see paper)
28% identity, 91% coverage: 36:427/429 of query aligns to 22:423/433 of 2xshA
- active site: H106 (= H121), D204 (= D224), H207 (= H227), H213 (≠ S233), D362 (= D376)
- binding 2,6-dichlorobiphenyl: F201 (≠ L222), M205 (≠ P225), H207 (= H227), Q296 (≠ V308), H297 (≠ T309), L307 (≠ Q320), F358 (≠ L372)
- binding fe (ii) ion: Q200 (≠ N221), H207 (= H227), H213 (≠ S233), D362 (= D376)
- binding fe2/s2 (inorganic) cluster: C83 (= C98), H85 (= H100), R86 (= R101), C103 (= C118), Y105 (= Y120), H106 (= H121), W108 (= W123)
2xrxA Crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400 (see paper)
27% identity, 91% coverage: 36:427/429 of query aligns to 22:422/432 of 2xrxA
- active site: H106 (= H121), D203 (= D224), H206 (= H227), H212 (≠ S233), D361 (= D376)
- binding biphenyl: Q199 (≠ N221), F200 (≠ L222), D203 (= D224), H206 (= H227), H296 (≠ T309), L306 (≠ Q320), F309 (≠ M323), F357 (≠ L372)
- binding fe (ii) ion: Q199 (≠ N221), H206 (= H227), H212 (≠ S233), D361 (= D376)
- binding fe2/s2 (inorganic) cluster: C83 (= C98), H85 (= H100), R86 (= R101), C103 (= C118), Y105 (= Y120), H106 (= H121), W108 (= W123)
2yflA Crystal structure of biphenyl dioxygenase variant rr41 with 2-chloro dibenzofuran (see paper)
27% identity, 91% coverage: 36:427/429 of query aligns to 22:423/433 of 2yflA
- active site: H106 (= H121), D204 (= D224), H207 (= H227), H213 (≠ S233), D362 (= D376)
- binding 2-chlorodibenzofuran: Q200 (≠ N221), D204 (= D224), M205 (≠ P225), H207 (= H227), S257 (≠ K269), H297 (≠ T309), L307 (≠ Q320), F352 (≠ M366)
- binding fe (ii) ion: Q200 (≠ N221), H207 (= H227), H213 (≠ S233), D362 (= D376)
- binding fe2/s2 (inorganic) cluster: C83 (= C98), H85 (= H100), R86 (= R101), C103 (= C118), Y105 (= Y120), H106 (= H121), W108 (= W123)
2yfjA Crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran (see paper)
27% identity, 91% coverage: 36:427/429 of query aligns to 22:423/433 of 2yfjA
- active site: H106 (= H121), D204 (= D224), H207 (= H227), H213 (≠ S233), D362 (= D376)
- binding dibenzofuran: Q200 (≠ N221), F201 (≠ L222), D204 (= D224), M205 (≠ P225), H207 (= H227), A208 (= A228), H297 (≠ T309), L307 (≠ Q320), F358 (≠ L372)
- binding fe (ii) ion: Q200 (≠ N221), H207 (= H227), H213 (≠ S233), D362 (= D376)
- binding fe2/s2 (inorganic) cluster: C83 (= C98), H85 (= H100), R86 (= R101), C103 (= C118), Y105 (= Y120), H106 (= H121), W108 (= W123)
1wqlA Cumene dioxygenase (cuma1a2) from pseudomonas fluorescens ip01 (see paper)
28% identity, 91% coverage: 36:427/429 of query aligns to 22:426/436 of 1wqlA
- active site: H106 (= H121), D208 (= D224), H211 (= H227), H217 (≠ S233), D365 (= D376)
- binding fe (ii) ion: H211 (= H227), H217 (≠ S233), D365 (= D376)
- binding fe2/s2 (inorganic) cluster: C83 (= C98), H85 (= H100), R86 (= R101), C103 (= C118), Y105 (= Y120), H106 (= H121), W108 (= W123)
- binding oxygen molecule: H211 (= H227), F355 (≠ M366)
3gzxA Crystal structure of the biphenyl dioxygenase in complex with biphenyl from comamonas testosteroni sp. Strain b-356 (see paper)
28% identity, 91% coverage: 36:427/429 of query aligns to 22:430/440 of 3gzxA
- active site: H106 (= H121), D213 (= D224), H216 (= H227), H222 (≠ S233), D369 (= D376)
- binding biphenyl: Q209 (≠ N221), F210 (≠ L222), H216 (= H227), G302 (≠ V308), H304 (≠ M310), L314 (≠ Q320)
- binding fe (ii) ion: Q209 (≠ N221), H216 (= H227), H222 (≠ S233), D369 (= D376)
- binding fe2/s2 (inorganic) cluster: C83 (= C98), H85 (= H100), R86 (= R101), C103 (= C118), Y105 (= Y120), H106 (= H121), W108 (= W123)
3en1A Crystal structure of toluene 2,3-dioxygenase (see paper)
30% identity, 91% coverage: 36:427/429 of query aligns to 21:422/424 of 3en1A
- active site: H105 (= H121), D205 (= D224), H208 (= H227), H214 (= H232), D360 (= D376)
- binding fe (ii) ion: Q201 (≠ N221), H208 (= H227), H214 (= H232), D360 (= D376)
- binding fe2/s2 (inorganic) cluster: C82 (= C98), H84 (= H100), R85 (= R101), C102 (= C118), Y104 (= Y120), H105 (= H121), W107 (= W123)
- binding toluene: Q201 (≠ N221), F202 (≠ L222), D205 (= D224), H208 (= H227), H295 (≠ M310)
2ckfE Crystal structure of the terminal component of the pah- hydroxylating dioxygenase from sphingomonas sp chy-1 (see paper)
26% identity, 91% coverage: 36:427/429 of query aligns to 19:401/433 of 2ckfE
- active site: H103 (= H121), D204 (= D224), H207 (= H227), H212 (= H232), D340 (= D376)
- binding fe (iii) ion: H207 (= H227), H212 (= H232), D340 (= D376)
- binding fe2/s2 (inorganic) cluster: C80 (= C98), H82 (= H100), R83 (= R101), C100 (= C118), Y102 (= Y120), H103 (= H121), W105 (= W123)
2gbxA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl (see paper)
26% identity, 91% coverage: 36:427/429 of query aligns to 14:416/449 of 2gbxA
- active site: H98 (= H121), D199 (= D224), H202 (= H227), H207 (= H232), D355 (= D376)
- binding biphenyl: D199 (= D224), V203 (≠ A228), L255 (vs. gap), H288 (≠ E301), N290 (≠ D303), L300 (≠ Q320)
- binding fe (iii) ion: H202 (= H227), H207 (= H232), D355 (= D376)
- binding fe2/s2 (inorganic) cluster: C75 (= C98), H77 (= H100), R78 (= R101), C95 (= C118), Y97 (= Y120), H98 (= H121), W100 (= W123)
2gbwA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 (see paper)
26% identity, 91% coverage: 36:427/429 of query aligns to 14:416/449 of 2gbwA
- active site: H98 (= H121), D199 (= D224), H202 (= H227), H207 (= H232), D355 (= D376)
- binding fe (iii) ion: H202 (= H227), H207 (= H232), D355 (= D376)
- binding fe2/s2 (inorganic) cluster: C75 (= C98), H77 (= H100), R78 (= R101), C95 (= C118), Y97 (= Y120), H98 (= H121), W100 (= W123)
- binding oxygen molecule: H202 (= H227), F345 (≠ M366), D355 (= D376)
8h2tB Cryo-em structure of iadd/e dioxygenase bound with iaa (see paper)
27% identity, 83% coverage: 36:393/429 of query aligns to 22:392/435 of 8h2tB
- binding fe (iii) ion: N208 (= N221), H214 (= H227), H219 (= H232), D375 (= D376)
- binding fe2/s2 (inorganic) cluster: C83 (= C98), H85 (= H100), K86 (≠ R101), C104 (= C118), H107 (= H121), W109 (= W123)
- binding 1h-indol-3-ylacetic acid: N208 (= N221), L209 (= L222), D211 (= D224), H214 (= H227), P215 (≠ A228), F249 (≠ V273), K320 (≠ Q320), Y360 (≠ R361)
Query Sequence
>RR42_RS26425 FitnessBrowser__Cup4G11:RR42_RS26425
MYQTHAVINRTPRAKDAELAACQWPEDALHFIPDWVYTSNAVYDLELEKIFRGRSWNFVA
LEAEIPNPGDFKRSYVGPTPVVVARAEDGSVNVFENRCAHRGAEFCRHGQGNAKEFVCPY
HQWSYDLKGNLQGVPFKRGVNRAGGMPKDFRNEDHGLVKLNVATRNGVIFASYANDMEPL
DVYMTPEILKDFDVVFNGKPLKILGYYKNELPCNWKMYHENLKDPYHATLLHSFLVVFGL
LVAGNDSAMIADPVHGRHGTMASAKKEDKYAAVSDENKKEMRSYHEGMRLQDDRFLEYIK
EFDSPWSVTMQTIWPNLIVQREMNTLGVRQIVPNGPDSMLMQWTMFGYEDDTEEMTRHRL
RQGNLMGPAGFLGLEDNEAMKFVQEGVRRSSTERNVLKLDPGHVGTANSLISESAIRAMY
QYYRSVMGF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory