Comparing RR42_RS26435 FitnessBrowser__Cup4G11:RR42_RS26435 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2qpzA Naphthalene 1,2-dioxygenase rieske ferredoxin (see paper)
50% identity, 96% coverage: 1:101/105 of query aligns to 2:102/103 of 2qpzA
P0A185 Naphthalene 1,2-dioxygenase system, ferredoxin component from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
50% identity, 96% coverage: 1:101/105 of query aligns to 3:103/104 of P0A185
Sites not aligning to the query:
5bokA Ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. Strain ds2
45% identity, 94% coverage: 3:101/105 of query aligns to 3:101/102 of 5bokA
1fqtA Crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase (see paper)
37% identity, 95% coverage: 1:100/105 of query aligns to 1:101/109 of 1fqtA
2i7fA Sphingomonas yanoikuyae b1 ferredoxin (see paper)
53% identity, 70% coverage: 27:100/105 of query aligns to 27:100/102 of 2i7fA
2e4pA Crystal structure of bpha3 (oxidized form) (see paper)
34% identity, 98% coverage: 3:105/105 of query aligns to 2:105/108 of 2e4pA
3dqyA Crystal structure of toluene 2,3-dioxygenase ferredoxin (see paper)
37% identity, 94% coverage: 3:101/105 of query aligns to 2:100/106 of 3dqyA
Q8GI16 Ferredoxin CarAc; Carbazole 1,9a-dioxygenase, ferredoxin component; CARDO from Pseudomonas resinovorans (see 2 papers)
33% identity, 92% coverage: 3:99/105 of query aligns to 5:102/107 of Q8GI16
4nbbE Carbazole- and oxygen-bound oxygenase with ile262 replaced by val and ferredoxin complex of carbazole 1,9a-dioxygenase (see paper)
33% identity, 92% coverage: 3:99/105 of query aligns to 4:101/114 of 4nbbE
P95483 Aminopyrrolnitrin oxygenase PrnD; Arylamine oxygenase; EC 1.14.13.- from Pseudomonas fluorescens (see 2 papers)
33% identity, 76% coverage: 2:81/105 of query aligns to 28:106/363 of P95483
Sites not aligning to the query:
3gceA Ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 (see paper)
30% identity, 90% coverage: 5:99/105 of query aligns to 5:101/104 of 3gceA
Q17938 Cholesterol 7-desaturase; Cholesterol desaturase daf-36; Rieske oxygenase DAF-36/Neverland; DAF-36/NVD; EC 1.14.19.21 from Caenorhabditis elegans (see paper)
31% identity, 79% coverage: 2:84/105 of query aligns to 80:165/428 of Q17938
Sites not aligning to the query:
6vshC Crystal structure of apo dicamba monooxygenase (see paper)
33% identity, 93% coverage: 2:99/105 of query aligns to 7:108/320 of 6vshC
3gobA Crystal structure of dicamba monooxygenase with non-heme cobalt and dcsa (see paper)
33% identity, 93% coverage: 2:99/105 of query aligns to 8:109/342 of 3gobA
Sites not aligning to the query:
3gkeA Crystal structure of dicamba monooxygenase (see paper)
33% identity, 93% coverage: 2:99/105 of query aligns to 7:108/340 of 3gkeA
Sites not aligning to the query:
3gb4A Crystal structure of dicamba monooxygenase with non-heme cobalt and dicamba (see paper)
33% identity, 93% coverage: 2:99/105 of query aligns to 7:108/341 of 3gb4A
Sites not aligning to the query:
Q5S3I3 Dicamba O-demethylase, oxygenase component; Dicamba monooxygenase; DMO; Three-component Rieske non-heme iron oxygenase system; EC 1.14.15.- from Stenotrophomonas maltophilia (Pseudomonas maltophilia) (Xanthomonas maltophilia) (see 3 papers)
33% identity, 93% coverage: 2:99/105 of query aligns to 7:108/339 of Q5S3I3
Sites not aligning to the query:
3gkeB Crystal structure of dicamba monooxygenase (see paper)
33% identity, 93% coverage: 2:99/105 of query aligns to 7:108/334 of 3gkeB
Sites not aligning to the query:
Q9MBA1 Chlorophyllide a oxygenase, chloroplastic; Chlorophyll a oxygenase; Chlorophyll b synthase; AtCAO; EC 1.14.13.122 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 81% coverage: 3:87/105 of query aligns to 221:305/536 of Q9MBA1
Sites not aligning to the query:
8jngA Methanesulfonate monooxygenase ferredoxin subunit of pbs-psii-psi-lhcs from porphyridium purpureum.
25% identity, 70% coverage: 2:75/105 of query aligns to 4:78/147 of 8jngA
>RR42_RS26435 FitnessBrowser__Cup4G11:RR42_RS26435
MAWTKIATTGQLQDDEVMPLTLGEAQLALYRSEGEYFVTDNVCTHQYALLSDGYLEDGCI
ECPLHQARFDIRTGQAMCAPATQGIKVYPVKIVDSDVLVDVMVTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory