Comparing RR42_RS26465 FitnessBrowser__Cup4G11:RR42_RS26465 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 43% coverage: 7:238/534 of query aligns to 28:275/572 of O42885
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 42% coverage: 17:238/534 of query aligns to 34:260/583 of Q9Y7Q9
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
23% identity, 41% coverage: 2:222/534 of query aligns to 16:222/444 of Q8NLB7
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
31% identity, 33% coverage: 47:223/534 of query aligns to 25:185/446 of A0A0H2VG78
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 30% coverage: 69:228/534 of query aligns to 178:325/616 of P36035
Sites not aligning to the query:
Q09852 Putative inorganic phosphate transporter C23D3.12 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 44% coverage: 3:237/534 of query aligns to 21:268/559 of Q09852
Sites not aligning to the query:
8fvzA Pipt y150a
22% identity, 57% coverage: 23:328/534 of query aligns to 4:313/433 of 8fvzA
Sites not aligning to the query:
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
28% identity, 28% coverage: 79:225/534 of query aligns to 203:346/727 of Q9Z2I6
Sites not aligning to the query:
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
28% identity, 28% coverage: 79:225/534 of query aligns to 203:346/727 of Q496J9
Sites not aligning to the query:
O57379 Solute carrier family 22 member 6; Organic anion transporter 1; Renal organic anion transporter 1; ROAT1; fROAT1 from Pseudopleuronectes americanus (Winter flounder) (Pleuronectes americanus) (see paper)
30% identity, 24% coverage: 79:208/534 of query aligns to 159:276/562 of O57379
Sites not aligning to the query:
>RR42_RS26465 FitnessBrowser__Cup4G11:RR42_RS26465
MTISLANDGAAVRKQGMTREERKVILASSFGALMEWYDFYIYAALAVYFGALFFPPGNET
TAFLASLATFGAGFLVRPVGALLFGRLGDKIGRKHTFLVTILLMGIATVGVGLLPTYGQI
GITATILLVVLRLLQGLALGGEVGGAVTYVAEHSPVEKRGLYTSSLQTTATLGLLSSLLV
VYLLKTLLTEAQFREWGWRLPFLVSFLMLVVSVYIRGKLHESPIFARMKAGNATSKSPIL
DSFTNWANLKYVLLLFVVASGLGAIFGTGHFYTMFFVNKTLHVPLELVHLLIGIALVIAT
PCYLFFGWLSDRIGRKHIMMAACLLAALTTQPIFRALTHYANPALEQFQQRNTVQLRAGD
CHFRLFAEPVSACDKVKGYLTDLGVGYEFTQIDAGAQPALRIGGTTLQGFDKAAIKQALV
AAGWTEHADPAAINRPMLFLMLLIPILLLAMVYGPLAAFMVELFPARIRYTSLSLPFHLG
AGWVGGMLSFVVTAMNVSSGNVYFGLWYPVSIAAIAFVVGMVFVPETRGRNLDT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory