SitesBLAST
Comparing RR42_RS26500 FitnessBrowser__Cup4G11:RR42_RS26500 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7dqxE Crystal structure of xanthine dehydrogenase family protein
33% identity, 81% coverage: 1:224/275 of query aligns to 1:226/293 of 7dqxE
- binding flavin-adenine dinucleotide: K29 (= K29), I30 (≠ V30), I31 (≠ M31), G33 (= G33), G34 (= G34), Q35 (= Q35), S36 (= S36), L37 (≠ M37), H78 (= H78), I101 (= I101), A102 (= A102), I106 (= I106), G110 (= G110), T111 (= T111), G113 (= G113), G114 (= G114), S115 (= S115), A117 (= A117), A123 (= A123), E124 (≠ D124), I167 (= I167), Y193 (≠ F193)
1ffuC Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
36% identity, 76% coverage: 6:213/275 of query aligns to 6:216/287 of 1ffuC
- binding flavin-adenine dinucleotide: K29 (= K29), L30 (≠ V30), A32 (≠ G32), G33 (= G33), G34 (= G34), H35 (≠ Q35), S36 (= S36), L37 (≠ M37), I54 (≠ L54), I101 (= I101), A102 (= A102), G110 (= G110), T111 (= T111), G114 (= G114), D115 (≠ S115), A117 (= A117), N123 (≠ A123), D124 (= D124), L161 (= L161), V166 (≠ L166), M167 (≠ I167), W193 (≠ F193)
1t3qC Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
37% identity, 79% coverage: 1:217/275 of query aligns to 1:217/285 of 1t3qC
- binding flavin-adenine dinucleotide: I29 (≠ V30), A31 (≠ G32), G32 (= G33), G33 (= G34), Q34 (= Q35), S35 (= S36), L36 (≠ M37), V100 (≠ I101), A101 (= A102), V105 (≠ I106), T110 (= T111), G113 (= G114), S114 (= S115), A116 (= A117), A122 (= A123), E123 (≠ D124), L166 (≠ I167), Y190 (≠ F193)
4zohB Crystal structure of glyceraldehyde oxidoreductase (see paper)
34% identity, 68% coverage: 9:194/275 of query aligns to 8:187/274 of 4zohB
- binding flavin-adenine dinucleotide: R28 (≠ K29), P29 (≠ V30), A31 (≠ G32), G32 (= G33), G33 (= G34), H34 (≠ Q35), S35 (= S36), L36 (≠ M37), H77 (= H78), I95 (= I101), G96 (≠ A102), V100 (≠ I106), T105 (= T111), G108 (= G114), S109 (= S115), S111 (≠ A117), A117 (= A123), D118 (= D124), L160 (= L166), V161 (≠ I167), D185 (≠ E192), F186 (= F193)
Sites not aligning to the query:
P19920 Carbon monoxide dehydrogenase medium chain; CO dehydrogenase subunit M; CO-DH M; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
33% identity, 70% coverage: 1:193/275 of query aligns to 1:193/288 of P19920
1n5wC Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
33% identity, 70% coverage: 1:193/275 of query aligns to 1:193/287 of 1n5wC
3hrdG Crystal structure of nicotinate dehydrogenase (see paper)
31% identity, 67% coverage: 6:189/275 of query aligns to 4:191/292 of 3hrdG
- binding flavin-adenine dinucleotide: I29 (≠ V30), A31 (≠ G32), G32 (= G33), G33 (= G34), T34 (≠ Q35), D35 (≠ S36), F77 (≠ H78), V100 (≠ I101), G101 (≠ A102), I105 (= I106), T110 (= T111), G113 (= G114), N114 (≠ S115), S116 (≠ A117), T117 (≠ H118), G122 (≠ A123), D123 (= D124), I168 (≠ L166), M169 (≠ I167)
Q0QLF4 Nicotinate dehydrogenase FAD-subunit; NDH; Nicotinic acid hydroxylase FAD-subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
31% identity, 67% coverage: 6:189/275 of query aligns to 4:191/296 of Q0QLF4
- 29:36 (vs. 30:37, 25% identical) binding
- G101 (≠ A102) binding
- TIGGN 110:114 (≠ TIGGS 111:115) binding
- D123 (= D124) binding
- R160 (≠ T158) binding
- M169 (≠ I167) binding
- K187 (= K185) binding
1jroA Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus (see paper)
29% identity, 61% coverage: 54:220/275 of query aligns to 213:379/450 of 1jroA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42, 43, 189, 191, 192, 193, 194, 195, 196
- binding fe2/s2 (inorganic) cluster: 37, 38, 39, 40, 42, 44, 45, 47, 63, 103, 106, 134, 136
2w54A Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde (see paper)
29% identity, 79% coverage: 4:220/275 of query aligns to 162:379/450 of 2w54A
- binding flavin-adenine dinucleotide: L189 (≠ V30), A191 (≠ G32), G192 (= G33), G193 (= G34), T194 (≠ Q35), D195 (≠ S36), V196 (≠ M37), W199 (≠ M40), L213 (= L54), F258 (≠ V97), A259 (= A98), A267 (≠ G110), T268 (= T111), G271 (= G114), N272 (≠ S115), A274 (= A117), N275 (≠ H118), G280 (≠ A123), D281 (= D124), R318 (≠ L161), V324 (≠ I167), Q347 (≠ E192)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 63, 103, 104, 106, 134, 135, 136
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: 102, 136
4uhxA Human aldehyde oxidase in complex with phthalazine and thioridazine (see paper)
23% identity, 59% coverage: 11:173/275 of query aligns to 211:383/1290 of 4uhxA
- binding flavin-adenine dinucleotide: P229 (≠ K29), V230 (= V30), I231 (≠ M31), M232 (≠ G32), G233 (= G33), N234 (≠ G34), T235 (≠ Q35), S236 (= S36), V237 (≠ M37), L310 (≠ R104), A311 (= A105), A319 (≠ G110), S320 (≠ T111), G323 (= G114), H324 (≠ S115), I326 (≠ A117), H329 (≠ D120), S332 (≠ A123), D333 (= D124), L377 (≠ I167)
Sites not aligning to the query:
- active site: 732, 767, 843, 847, 875, 1223, 1224
- binding flavin-adenine dinucleotide: 43, 44, 404
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 111, 112, 114, 146, 148
- binding 10-{2-[(2S)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020, 1079
- binding 10-{2-[(2R)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020
7orcB Human aldehyde oxidase in complex with raloxifene (see paper)
23% identity, 59% coverage: 11:173/275 of query aligns to 210:382/1299 of 7orcB
- binding flavin-adenine dinucleotide: P228 (≠ K29), V229 (= V30), I230 (≠ M31), M231 (≠ G32), G232 (= G33), N233 (≠ G34), T234 (≠ Q35), S235 (= S36), V236 (≠ M37), L309 (≠ R104), A310 (= A105), A318 (≠ G110), S319 (≠ T111), G322 (= G114), H323 (≠ S115), S326 (≠ H118), H328 (≠ D120), S331 (≠ A123), D332 (= D124), L376 (≠ I167)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 403
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 111, 112, 114, 146, 148, 716
- binding raloxifene: 417, 418, 419, 449, 451, 506, 507, 616, 619, 740, 743, 746
Q06278 Aldehyde oxidase; Aldehyde oxidase 1; Azaheterocycle hydroxylase; EC 1.2.3.1; EC 1.17.3.- from Homo sapiens (Human) (see 3 papers)
23% identity, 59% coverage: 11:173/275 of query aligns to 245:417/1338 of Q06278
- 264:271 (vs. 30:37, 38% identical) binding
- A345 (= A105) binding
- S354 (≠ T111) binding
- H358 (≠ S115) binding
- D367 (= D124) binding
- L411 (≠ I167) binding
Sites not aligning to the query:
- 44 binding ; C→W: Disrupts protein stability.
- 49 binding
- 52 binding
- 74 binding
- 113 binding
- 114 binding
- 117 binding
- 149 binding
- 151 binding ; binding
- 802 R → C: decreases homodimerization but nearly no effect on kinetic parameters; dbSNP:rs41309768
- 806:807 binding
- 921 R → H: increases homodimerization; abolishes enzymatic activity on phenanthridine; decreases turnover number with benzaldehyde, phtalazine and chloroquinazolinone as substrate, while nearly no effect on the KM; dbSNP:rs56199635
- 1047 binding
- 1088:1091 binding
- 1135 N → S: increases homodimerization and turnover number with phenanthridine as substrate; nearly no effect on kinetic parameters with benzaldehyde, phtalazine and chloroquinazolinone as substrate; dbSNP:rs55754655
- 1203 binding
- 1268 binding
- 1269 G→R: No effect on dimerization. Loss of oxidase activity.
- 1271 S → L: no effect on dimerization; no effect on oxidase activity; dbSNP:rs141786030
- 1297 H → R: increases homodimerization and turnover number with phenanthridine as substrate; nearly no effect on kinetic parameters with benzaldehyde, phtalazine and chloroquinazolinone as substrate; dbSNP:rs3731722
8emtB Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
23% identity, 59% coverage: 11:173/275 of query aligns to 192:364/1221 of 8emtB
- binding flavin-adenine dinucleotide: P210 (≠ K29), V211 (= V30), M213 (≠ G32), G214 (= G33), T216 (≠ Q35), S217 (= S36), V218 (≠ M37), L291 (≠ R104), A292 (= A105), A300 (≠ G110), G304 (= G114), H305 (≠ S115), I307 (≠ A117), D314 (= D124)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 69, 109, 112, 144, 146
8emtA Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
23% identity, 59% coverage: 11:173/275 of query aligns to 197:369/1254 of 8emtA
- binding flavin-adenine dinucleotide: P215 (≠ K29), V216 (= V30), I217 (≠ M31), M218 (≠ G32), G219 (= G33), T221 (≠ Q35), S222 (= S36), V223 (≠ M37), L296 (≠ R104), A297 (= A105), S306 (≠ T111), G309 (= G114), H310 (≠ S115), I312 (≠ A117), D319 (= D124)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 45, 46, 49, 69, 71, 111, 112, 114, 146, 148
1vdvA Bovine milk xanthine dehydrogenase y-700 bound form (see paper)
22% identity, 70% coverage: 15:206/275 of query aligns to 211:418/1299 of 1vdvA
- binding flavin-adenine dinucleotide: L229 (≠ V30), V230 (≠ M31), V231 (≠ G32), G232 (= G33), N233 (≠ G34), T234 (≠ Q35), E235 (≠ S36), I236 (≠ M37), F309 (vs. gap), A310 (= A102), A318 (≠ G110), S319 (≠ T111), G322 (= G114), N323 (≠ S115), I325 (≠ A117), T326 (≠ H118), S331 (≠ A123), D332 (= D124), I375 (≠ L166), L376 (≠ I167)
Sites not aligning to the query:
- active site: 734, 769, 847, 851, 879, 1227, 1228
- binding calcium ion: 708, 710, 803, 804, 834, 837, 838, 841, 874, 875
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 711
- binding 1-[3-cyano-4-(neopentyloxy)phenyl]-1h-pyrazole-4-carboxylic acid: 769, 840, 843, 847, 881, 976, 977, 978, 981, 1043, 1046
1v97A Crystal structure of bovine milk xanthine dehydrogenase fyx-051 bound form (see paper)
22% identity, 70% coverage: 15:206/275 of query aligns to 211:418/1298 of 1v97A
- binding flavin-adenine dinucleotide: K228 (= K29), L229 (≠ V30), V230 (≠ M31), V231 (≠ G32), G232 (= G33), N233 (≠ G34), T234 (≠ Q35), E235 (≠ S36), I236 (≠ M37), F309 (vs. gap), A310 (= A102), A318 (≠ G110), S319 (≠ T111), G322 (= G114), N323 (≠ S115), I325 (≠ A117), T326 (≠ H118), S331 (≠ A123), D332 (= D124), I375 (≠ L166), L376 (≠ I167)
Sites not aligning to the query:
- active site: 733, 768, 846, 850, 878, 1226, 1227
- binding calcium ion: 833, 836, 837, 840, 873, 874
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 710
- binding 4-(5-pyridin-4-yl-1h-1,2,4-triazol-3-yl)pyridine-2-carbonitrile: 768, 839, 846, 880, 975, 980, 1042, 1044, 1045, 1227
1fo4A Crystal structure of xanthine dehydrogenase isolated from bovine milk (see paper)
22% identity, 70% coverage: 15:206/275 of query aligns to 211:418/1299 of 1fo4A
- binding flavin-adenine dinucleotide: K228 (= K29), L229 (≠ V30), V230 (≠ M31), V231 (≠ G32), G232 (= G33), N233 (≠ G34), T234 (≠ Q35), E235 (≠ S36), I236 (≠ M37), F309 (vs. gap), A310 (= A102), A318 (≠ G110), S319 (≠ T111), G322 (= G114), N323 (≠ S115), I325 (≠ A117), S331 (≠ A123), D332 (= D124), I375 (≠ L166), L376 (≠ I167)
Sites not aligning to the query:
- active site: 734, 769, 847, 851, 879, 1227, 1228
- binding calcium ion: 834, 837, 838, 841, 874, 875
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 147, 148, 711
3amzA Bovine xanthine oxidoreductase urate bound form (see paper)
22% identity, 70% coverage: 15:206/275 of query aligns to 211:418/1291 of 3amzA
- binding flavin-adenine dinucleotide: L229 (≠ V30), V230 (≠ M31), V231 (≠ G32), G232 (= G33), N233 (≠ G34), T234 (≠ Q35), E235 (≠ S36), I236 (≠ M37), F309 (vs. gap), A318 (≠ G110), S319 (≠ T111), G322 (= G114), N323 (≠ S115), I325 (≠ A117), T326 (≠ H118), S331 (≠ A123), D332 (= D124), I375 (≠ L166), L376 (≠ I167)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S328 (≠ D120), P329 (= P121), I330 (≠ A122), Y365 (= Y157), R366 (vs. gap), D402 (≠ E192), I403 (≠ F193)
Sites not aligning to the query:
- active site: 731, 766, 844, 848, 876, 1224, 1225
- binding bicarbonate ion: 803, 804, 873, 874, 878, 879, 882
- binding calcium ion: 831, 834, 835, 838, 871, 872
- binding flavin-adenine dinucleotide: 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 708
- binding 1,4-dihydronicotinamide adenine dinucleotide: 430, 432, 433, 473, 480, 1189
- binding uric acid: 766, 844, 878, 973, 974, 1043, 1225
3unaA Crystal structure of bovine milk xanthine dehydrogenase with NAD bound (see paper)
22% identity, 70% coverage: 15:206/275 of query aligns to 209:416/1286 of 3unaA
- binding flavin-adenine dinucleotide: L227 (≠ V30), V228 (≠ M31), V229 (≠ G32), G230 (= G33), N231 (≠ G34), T232 (≠ Q35), E233 (≠ S36), I234 (≠ M37), F307 (vs. gap), A308 (= A102), A316 (≠ G110), S317 (≠ T111), G320 (= G114), N321 (≠ S115), I323 (≠ A117), T324 (≠ H118), S329 (≠ A123), D330 (= D124), I373 (≠ L166), L374 (≠ I167)
- binding nicotinamide-adenine-dinucleotide: P327 (= P121), Y363 (= Y157), R364 (vs. gap)
Sites not aligning to the query:
- active site: 729, 764, 842, 846, 874, 1222, 1223
- binding calcium ion: 829, 832, 833, 836, 869, 870
- binding carbonate ion: 801, 802, 871, 872, 876, 877, 880
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148, 706
- binding nicotinamide-adenine-dinucleotide: 430, 431, 471, 478
Query Sequence
>RR42_RS26500 FitnessBrowser__Cup4G11:RR42_RS26500
MKAAAFTYHAAPTLAATCAELADRTDNAKVMGGGQSMGPMLNLRLTRPDAIYDLSKLAEL
RTVTLLQDRVRIGAAVTHAQIEDGEFPALRGGMLQSVASGIAYRAIRNRGTIGGSLAHAD
PAADWVVVLTAVGAQIELASKAGTRIVPMTAFMLGAYTTALTEGELICAVHVPSQPDTAR
WGYHKLCRKTGEFAEASCAAYFDPSTRFARIALGALDGAPALLRGLANDIAAQGPAALTP
QAVLAAVTQATPAKDAIDRKLCCAAVTRCIEQLFN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory