SitesBLAST
Comparing RR42_RS26505 FitnessBrowser__Cup4G11:RR42_RS26505 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1t3qA Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
47% identity, 41% coverage: 4:163/389 of query aligns to 6:158/162 of 1t3qA
- binding fe2/s2 (inorganic) cluster: I40 (≠ L38), C42 (= C40), E43 (= E41), G45 (= G43), C47 (= C45), G48 (= G46), C50 (= C48), R60 (= R58), C62 (= C60), C101 (= C99), G102 (= G100), C104 (= C102), C136 (= C134), C138 (= C136)
- binding pterin cytosine dinucleotide: Q100 (= Q98), C138 (= C136)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
47% identity, 38% coverage: 2:147/389 of query aligns to 3:148/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (= C40), S44 (≠ G43), H45 (≠ V44), C46 (= C45), G47 (= G46), C49 (= C48), C61 (= C60), C100 (= C99), G101 (= G100), C103 (= C102), C135 (= C134), C137 (= C136)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
47% identity, 38% coverage: 2:147/389 of query aligns to 2:147/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (≠ L38), C40 (= C40), S43 (≠ G43), C45 (= C45), G46 (= G46), C48 (= C48), C60 (= C60), C99 (= C99), G100 (= G100), C102 (= C102), C134 (= C134), C136 (= C136)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (= Q98), C136 (= C136)
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
45% identity, 37% coverage: 4:148/389 of query aligns to 12:155/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: C47 (= C40), S50 (≠ G43), C52 (= C45), G53 (= G46), C55 (= C48), C67 (= C60), C106 (= C99), G107 (= G100), C109 (= C102), C141 (= C134), C143 (= C136)
- binding pterin cytosine dinucleotide: Q105 (= Q98), C143 (= C136)
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
47% identity, 37% coverage: 4:146/389 of query aligns to 6:149/166 of P19921
- C42 (= C40) binding
- C47 (= C45) binding
- C50 (= C48) binding
- C62 (= C60) binding
- C102 (= C99) binding
- C105 (= C102) binding
- C137 (= C134) binding
- C139 (= C136) binding
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
47% identity, 37% coverage: 4:146/389 of query aligns to 4:147/161 of 1n5wA
- binding flavin-adenine dinucleotide: S43 (≠ G43), H44 (≠ V44)
- binding fe2/s2 (inorganic) cluster: I38 (≠ L38), G39 (= G39), C40 (= C40), S43 (≠ G43), C45 (= C45), G46 (= G46), C48 (= C48), C60 (= C60), C100 (= C99), G101 (= G100), C103 (= C102), C135 (= C134), C137 (= C136)
1n5wD Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
47% identity, 37% coverage: 4:146/389 of query aligns to 4:147/158 of 1n5wD
- binding flavin-adenine dinucleotide: S43 (≠ G43), H44 (≠ V44)
- binding fe2/s2 (inorganic) cluster: C40 (= C40), S43 (≠ G43), C45 (= C45), G46 (= G46), C48 (= C48), C60 (= C60), C100 (= C99), G101 (= G100), C103 (= C102), C135 (= C134), C137 (= C136)
- binding pterin cytosine dinucleotide: Q99 (= Q98), C137 (= C136)
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
42% identity, 39% coverage: 4:153/389 of query aligns to 5:154/161 of 1sb3C
- binding fe2/s2 (inorganic) cluster: Q39 (≠ L38), C41 (= C40), G44 (= G43), C46 (= C45), G47 (= G46), C49 (= C48), C61 (= C60), C100 (= C99), G101 (= G100), C103 (= C102), C135 (= C134), C137 (= C136)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q98), C137 (= C136)
7dqxC Crystal structure of xanthine dehydrogenase family protein
43% identity, 39% coverage: 4:153/389 of query aligns to 6:156/160 of 7dqxC
- binding fe2/s2 (inorganic) cluster: C42 (= C40), G45 (= G43), V46 (= V44), C47 (= C45), C50 (= C48), R60 (= R58), C62 (= C60), Q100 (= Q98), C101 (= C99), C104 (= C102), C137 (= C134), C139 (= C136)
- binding pterin cytosine dinucleotide: Q100 (= Q98), C139 (= C136)
3hrdD Crystal structure of nicotinate dehydrogenase (see paper)
42% identity, 37% coverage: 3:146/389 of query aligns to 5:148/160 of 3hrdD
- binding flavin-adenine dinucleotide: E44 (≠ H42), G45 (= G43), E46 (≠ V44)
- binding fe2/s2 (inorganic) cluster: E40 (≠ L38), C42 (= C40), S43 (≠ E41), G45 (= G43), C47 (= C45), G48 (= G46), C50 (= C48), C62 (= C60), Q100 (= Q98), C101 (= C99), G102 (= G100), C104 (= C102), C136 (= C134), C138 (= C136)
- binding pterin cytosine dinucleotide: Q100 (= Q98), C138 (= C136)
Q0QLF3 Nicotinate dehydrogenase small FeS subunit; NDH; Nicotinic acid hydroxylase small FeS subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
42% identity, 37% coverage: 3:146/389 of query aligns to 5:148/157 of Q0QLF3
- C42 (= C40) binding
- C47 (= C45) binding
- C50 (= C48) binding
- C62 (= C60) binding
- C101 (= C99) binding
- C104 (= C102) binding
- C136 (= C134) binding
- C138 (= C136) binding
P77165 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
38% identity, 37% coverage: 4:146/389 of query aligns to 63:220/229 of P77165
- C99 (= C40) binding
- C104 (= C45) binding
- G105 (= G46) binding
- C107 (= C48) binding
- C119 (= C60) binding
- C158 (= C99) binding
- C161 (= C102) binding
- C208 (= C134) binding
- C210 (= C136) binding
5g5gA Escherichia coli periplasmic aldehyde oxidase (see paper)
38% identity, 37% coverage: 4:146/389 of query aligns to 12:169/175 of 5g5gA
- binding fe2/s2 (inorganic) cluster: G47 (= G39), C48 (= C40), D49 (≠ E41), G51 (= G43), C53 (= C45), G54 (= G46), C56 (= C48), C68 (= C60), C107 (= C99), G108 (= G100), C110 (= C102), C157 (= C134), C159 (= C136)
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
40% identity, 38% coverage: 3:151/389 of query aligns to 4:153/157 of 5y6qA
- binding fe2/s2 (inorganic) cluster: G40 (= G39), C41 (= C40), D42 (≠ E41), G44 (= G43), C46 (= C45), G47 (= G46), C49 (= C48), C61 (= C60), C101 (= C99), G102 (= G100), C104 (= C102), C136 (= C134), C138 (= C136)
- binding pterin cytosine dinucleotide: Q100 (= Q98), C138 (= C136)
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
38% identity, 40% coverage: 1:154/389 of query aligns to 1:157/906 of 1dgjA
- binding fe2/s2 (inorganic) cluster: V38 (≠ L38), G39 (= G39), C40 (= C40), G41 (≠ E41), G43 (= G43), Q44 (≠ V44), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C99), G101 (= G100), C103 (= C102), C137 (= C134), C139 (= C136)
- binding pterin cytosine dinucleotide: Q99 (= Q98), C139 (= C136)
Sites not aligning to the query:
- active site: 391, 427, 503, 507, 535, 869, 870
- binding molybdenum (iv)oxide: 424, 535, 698, 869
- binding pterin cytosine dinucleotide: 423, 424, 535, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
36% identity, 39% coverage: 6:155/389 of query aligns to 6:161/907 of 4usaA
- binding fe2/s2 (inorganic) cluster: V38 (≠ L38), C40 (= C40), E41 (= E41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C99), G101 (= G100), C103 (= C102), C137 (= C134), C139 (= C136)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q98), C139 (= C136)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 531, 532, 535, 539
- binding hydrocinnamic acid: 255, 425, 494, 497, 535, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
36% identity, 39% coverage: 6:155/389 of query aligns to 6:161/907 of 4us9A
- binding fe2/s2 (inorganic) cluster: V38 (≠ L38), C40 (= C40), E41 (= E41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C99), G101 (= G100), C103 (= C102), C137 (= C134), C139 (= C136)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q98), C139 (= C136)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 3-phenylpropanal: 255, 257, 258, 752
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
36% identity, 39% coverage: 6:155/389 of query aligns to 6:161/907 of 4us8A
- binding fe2/s2 (inorganic) cluster: V38 (≠ L38), C40 (= C40), E41 (= E41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C99), G101 (= G100), C103 (= C102), C137 (= C134), C139 (= C136)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q98), C139 (= C136)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539
- binding benzaldehyde: 255, 255, 394, 425, 425, 425, 425, 497, 497, 501, 531, 535, 535, 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
36% identity, 39% coverage: 6:155/389 of query aligns to 6:161/907 of 4c7yA
- binding fe2/s2 (inorganic) cluster: C40 (= C40), E41 (= E41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C99), G101 (= G100), C103 (= C102), C137 (= C134), C139 (= C136)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q98), C139 (= C136)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 535, 539
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
36% identity, 39% coverage: 6:155/389 of query aligns to 6:161/907 of 3fc4A
- binding fe2/s2 (inorganic) cluster: V38 (≠ L38), C40 (= C40), E41 (= E41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C99), G101 (= G100), C103 (= C102), C137 (= C134), C139 (= C136)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q98), C139 (= C136)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 1,2-ethanediol: 535, 622, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Query Sequence
>RR42_RS26505 FitnessBrowser__Cup4G11:RR42_RS26505
METITLTINGRAAAGACAHRTHLGDFLRDAQGLTGTHLGCEHGVCGACTVLVDDKPVRSC
ITFASACAGSNVVTIEGYDDDPVMRDLRTAFNQHHALQCGYCTPGMLATARDIVLRLPDA
DEATIRHELSGNLCRCTGYMGIVAAISSVLALRKPPAAGKAAQAVAATVKREFACFTPAA
DSAVQAHAEPAAREEAERSADKKGWSRIDGSFKVPFPADDVWRFMADLPAVASCLPGAAL
TEQDGDRVKGHVAIKFGPMAARFNGAARLERDDANRRGVLKGAGQDSLSNSKAAGDITYV
LQAISAGETEVLIDLQYALQGPLAQFSRSGLVRDFVRRMMADFGKNVARKMDPSLSQSER
SQATQMNPVSMMLGVMWERVKRLFGGGRD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory