Comparing RR42_RS26540 FitnessBrowser__Cup4G11:RR42_RS26540 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
35% identity, 87% coverage: 42:311/311 of query aligns to 42:314/533 of O43175
Sites not aligning to the query:
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
36% identity, 81% coverage: 42:293/311 of query aligns to 37:291/302 of 7ewhA
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
36% identity, 81% coverage: 42:293/311 of query aligns to 37:291/302 of 6rihA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
36% identity, 81% coverage: 42:293/311 of query aligns to 37:291/301 of 6rj5A
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
36% identity, 81% coverage: 42:293/311 of query aligns to 37:291/303 of 6plgA
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
36% identity, 81% coverage: 42:293/311 of query aligns to 34:288/299 of 6rj2A
7dkmA Phgdh covalently linked to oridonin (see paper)
36% identity, 81% coverage: 42:293/311 of query aligns to 38:292/306 of 7dkmA
Sites not aligning to the query:
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
36% identity, 81% coverage: 42:293/311 of query aligns to 38:292/305 of 6plfA
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
36% identity, 81% coverage: 42:293/311 of query aligns to 36:290/297 of 6rj3A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
36% identity, 81% coverage: 42:293/311 of query aligns to 36:290/299 of 6cwaA
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
36% identity, 81% coverage: 42:293/311 of query aligns to 32:282/292 of 6plfB
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
35% identity, 95% coverage: 8:304/311 of query aligns to 3:302/304 of 1wwkA
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
37% identity, 95% coverage: 5:299/311 of query aligns to 3:297/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
37% identity, 95% coverage: 5:299/311 of query aligns to 2:296/526 of 3dc2A
Sites not aligning to the query:
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 88% coverage: 25:298/311 of query aligns to 77:362/466 of P87228
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
34% identity, 78% coverage: 58:301/311 of query aligns to 57:309/334 of 5aovA
Sites not aligning to the query:
7cvpA The crystal structure of human phgdh from biortus.
36% identity, 65% coverage: 91:293/311 of query aligns to 41:245/254 of 7cvpA
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
37% identity, 60% coverage: 101:288/311 of query aligns to 3:192/195 of 5ofwA
5ofvA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-fluoro-2-methylbenzoic acid (see paper)
37% identity, 60% coverage: 101:288/311 of query aligns to 3:192/195 of 5ofvA
5ofmA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-amino-1-methyl-1h-indole
37% identity, 60% coverage: 101:288/311 of query aligns to 3:192/195 of 5ofmA
>RR42_RS26540 FitnessBrowser__Cup4G11:RR42_RS26540
MSTKPAILVTAADLAPQAEALLGDFEIVYAGKTPQAADLVALAQRHNPVGIIVRYGAVTP
EIMDAAPALKVISKHGSGTDTIDKPAAAARGIAVTAAVGANAAAVAEQAMALLLGCAKSL
VQLNERMHAGHWDKATHKSVELAGRTIGLIGLGAIGRRFARMCDAMGMRVIGFDPFAADL
PGYIEPVDLDAIWREADAISLHCPLTPGNRAMINAQTLAQCKQGVILVNTARGGLIDEPA
LLAAVQSGQVAVAGLDSFAVEPMTVPHIFHGQPGFLLSPHIGGVTSAAYVNMGVAAAQNT
LGVLAALSVAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory