SitesBLAST
Comparing RR42_RS26635 FitnessBrowser__Cup4G11:RR42_RS26635 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
47% identity, 99% coverage: 1:462/466 of query aligns to 10:465/465 of 3pm9A
- active site: A149 (= A142), L159 (≠ N152)
- binding flavin-adenine dinucleotide: P69 (= P60), Q70 (= Q61), G71 (= G62), G72 (= G63), N73 (= N64), T74 (= T65), G75 (≠ S66), L76 (= L67), G79 (= G70), Q80 (≠ A71), L91 (= L84), L133 (≠ I126), G134 (= G127), A135 (≠ S128), C139 (= C132), T140 (≠ Q133), G142 (= G135), G143 (= G136), S146 (≠ A139), T147 (= T140), A149 (= A142), G150 (= G143), E200 (= E193), G201 (= G194), I205 (= I198), I206 (= I199), E423 (= E420)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
41% identity, 95% coverage: 23:463/466 of query aligns to 38:465/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R323), T337 (≠ S327), K348 (= K338), Y379 (= Y371), H381 (= H373), H388 (= H380), H423 (= H421)
- binding flavin-adenine dinucleotide: W39 (≠ Y24), P75 (= P60), Q76 (= Q61), G77 (= G62), G78 (= G63), N79 (= N64), T80 (= T65), G81 (≠ S66), M82 (≠ L67), G85 (= G70), S86 (≠ A71), L139 (≠ I126), G140 (= G127), A141 (≠ S128), C145 (= C132), G149 (= G136), N150 (= N137), A152 (= A139), T153 (= T140), G157 (= G144), G207 (= G194), I212 (= I199), E422 (= E420), N459 (= N457)
- binding zinc ion: H381 (= H373), H388 (= H380), E422 (= E420)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
41% identity, 95% coverage: 23:463/466 of query aligns to 38:465/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (≠ Y24), P75 (= P60), G77 (= G62), G78 (= G63), N79 (= N64), T80 (= T65), G81 (≠ S66), G85 (= G70), S86 (≠ A71), L139 (≠ I126), G140 (= G127), A141 (≠ S128), C145 (= C132), H146 (≠ Q133), G148 (= G135), G149 (= G136), N150 (= N137), A152 (= A139), T153 (= T140), A155 (= A142), E206 (= E193), G207 (= G194), I211 (= I198), I212 (= I199), E422 (= E420), N459 (= N457)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R323), T337 (≠ S327), K348 (= K338), Y379 (= Y371), H381 (= H373), H388 (= H380), H423 (= H421)
- binding zinc ion: H381 (= H373), H388 (= H380), E422 (= E420)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
41% identity, 95% coverage: 23:463/466 of query aligns to 38:465/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (≠ Y24), P75 (= P60), G77 (= G62), G78 (= G63), N79 (= N64), T80 (= T65), G81 (≠ S66), G85 (= G70), S86 (≠ A71), L139 (≠ I126), G140 (= G127), A141 (≠ S128), C145 (= C132), H146 (≠ Q133), G149 (= G136), N150 (= N137), A152 (= A139), T153 (= T140), A155 (= A142), G157 (= G144), E206 (= E193), G207 (= G194), I211 (= I198), I212 (= I199), E422 (= E420), N459 (= N457)
- binding d-malate: M82 (≠ L67), R333 (= R323), T337 (≠ S327), K348 (= K338), Y379 (= Y371), H381 (= H373), H388 (= H380), E422 (= E420), H423 (= H421)
- binding zinc ion: H381 (= H373), H388 (= H380), E422 (= E420)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
41% identity, 95% coverage: 23:463/466 of query aligns to 38:465/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R323), T337 (≠ S327), K348 (= K338), Y379 (= Y371), H381 (= H373), H388 (= H380), N390 (= N382), H423 (= H421)
- binding flavin-adenine dinucleotide: W39 (≠ Y24), P75 (= P60), G77 (= G62), G78 (= G63), N79 (= N64), T80 (= T65), G81 (≠ S66), M82 (≠ L67), G85 (= G70), S86 (≠ A71), L139 (≠ I126), G140 (= G127), A141 (≠ S128), C145 (= C132), G149 (= G136), N150 (= N137), A152 (= A139), T153 (= T140), A155 (= A142), G157 (= G144), G207 (= G194), I212 (= I199), E422 (= E420), H423 (= H421)
- binding zinc ion: H381 (= H373), H388 (= H380), E422 (= E420)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
41% identity, 95% coverage: 23:463/466 of query aligns to 39:466/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (≠ Y24), P76 (= P60), G78 (= G62), G79 (= G63), N80 (= N64), T81 (= T65), G82 (≠ S66), M83 (≠ L67), G86 (= G70), S87 (≠ A71), L140 (≠ I126), A142 (≠ S128), C146 (= C132), H147 (≠ Q133), G150 (= G136), N151 (= N137), A153 (= A139), T154 (= T140), G208 (= G194), I212 (= I198), I213 (= I199), E423 (= E420), N460 (= N457)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
41% identity, 95% coverage: 23:463/466 of query aligns to 91:518/521 of Q8N465
- S109 (≠ T41) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V59) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G63) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ L81) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (= M87) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V106) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A123) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A139) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ P165) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G167) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S312) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R323) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ S327) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ S336) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K338) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ S356) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (= A366) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H373) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G375) to V: slight reduction in catalytic activity
- N439 (= N378) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H380) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N382) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ R389) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (= A391) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E420) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H421) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G422) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
35% identity, 99% coverage: 1:462/466 of query aligns to 35:496/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
34% identity, 92% coverage: 33:461/466 of query aligns to 46:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P60), G75 (= G62), S76 (≠ G63), G77 (≠ N64), T78 (= T65), G79 (≠ S66), L80 (= L67), A83 (≠ G70), C84 (≠ A71), P137 (≠ G127), G138 (≠ S128), E139 (= E129), A142 (≠ C132), T143 (≠ Q133), G146 (= G136), N147 (= N137), S149 (≠ A139), T150 (= T140), A152 (= A142), G153 (= G143), E203 (= E193), G204 (= G194), I209 (= I199), E422 (= E420), H423 (= H421)
- binding fe (iii) ion: H377 (= H373), H384 (= H380), E422 (= E420)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
31% identity, 99% coverage: 1:462/466 of query aligns to 9:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R323), W322 (vs. gap), H369 (= H373), H376 (= H380), H414 (= H421)
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ G63), G72 (≠ N64), T73 (= T65), G74 (≠ S66), G78 (= G70), V79 (≠ A71), L90 (= L84), P132 (≠ I126), G133 (= G127), A134 (≠ S128), G140 (= G136), M141 (≠ N137), A143 (= A139), T144 (= T140), A146 (= A142), S147 (≠ G143), E200 (= E193), G201 (= G194), I206 (= I199), W322 (vs. gap), E413 (= E420), N450 (= N457)
- binding manganese (ii) ion: H369 (= H373), H376 (= H380), E413 (= E420)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
31% identity, 99% coverage: 1:462/466 of query aligns to 9:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ G63), G72 (≠ N64), T73 (= T65), G74 (≠ S66), G78 (= G70), V79 (≠ A71), L90 (= L84), P132 (≠ I126), G133 (= G127), A134 (≠ S128), G140 (= G136), M141 (≠ N137), A143 (= A139), T144 (= T140), A146 (= A142), S147 (≠ G143), E200 (= E193), G201 (= G194), I206 (= I199), W322 (vs. gap), E413 (= E420), H414 (= H421), N450 (= N457)
- binding lactic acid: R318 (= R323), H369 (= H373), H376 (= H380), H414 (= H421)
- binding manganese (ii) ion: H369 (= H373), H376 (= H380), E413 (= E420)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
31% identity, 99% coverage: 1:462/466 of query aligns to 9:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L67), R317 (= R323), W321 (vs. gap), H368 (= H373), H375 (= H380), H413 (= H421)
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ G63), G72 (≠ N64), T73 (= T65), G74 (≠ S66), G78 (= G70), V79 (≠ A71), L90 (= L84), P132 (≠ I126), G133 (= G127), A134 (≠ S128), G140 (= G136), M141 (≠ N137), A143 (= A139), T144 (= T140), A146 (= A142), S147 (≠ G143), E200 (= E193), G201 (= G194), I206 (= I199), W321 (vs. gap), Y322 (vs. gap), E412 (= E420), H413 (= H421), N449 (= N457)
- binding manganese (ii) ion: H368 (= H373), H375 (= H380), E412 (= E420)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
31% identity, 99% coverage: 1:462/466 of query aligns to 9:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R323), W322 (vs. gap), H369 (= H373), H376 (= H380), H413 (= H421)
- binding flavin-adenine dinucleotide: E32 (≠ Y24), P68 (= P60), G70 (= G62), T71 (≠ G63), G72 (≠ N64), T73 (= T65), G74 (≠ S66), G78 (= G70), V79 (≠ A71), L90 (= L84), P132 (≠ I126), G133 (= G127), A134 (≠ S128), G140 (= G136), M141 (≠ N137), A143 (= A139), T144 (= T140), A146 (= A142), S147 (≠ G143), E200 (= E193), G201 (= G194), I206 (= I199), W322 (vs. gap), E412 (= E420), H413 (= H421), N449 (= N457)
- binding manganese (ii) ion: H369 (= H373), H376 (= H380), E412 (= E420)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
31% identity, 99% coverage: 1:462/466 of query aligns to 9:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R323), W322 (vs. gap), S336 (≠ K338), H369 (= H373), H376 (= H380), H413 (= H421)
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ G63), G72 (≠ N64), T73 (= T65), G74 (≠ S66), G78 (= G70), V79 (≠ A71), L90 (= L84), P132 (≠ I126), G133 (= G127), A134 (≠ S128), G140 (= G136), M141 (≠ N137), A143 (= A139), T144 (= T140), A146 (= A142), S147 (≠ G143), E200 (= E193), G201 (= G194), I206 (= I199), E412 (= E420), N449 (= N457)
- binding manganese (ii) ion: H369 (= H373), H376 (= H380), E412 (= E420)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
31% identity, 99% coverage: 1:462/466 of query aligns to 9:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ Y24), P68 (= P60), G70 (= G62), T71 (≠ G63), G72 (≠ N64), T73 (= T65), G74 (≠ S66), G78 (= G70), V79 (≠ A71), L90 (= L84), P132 (≠ I126), G133 (= G127), A134 (≠ S128), G140 (= G136), M141 (≠ N137), A143 (= A139), T144 (= T140), A146 (= A142), S147 (≠ G143), E200 (= E193), G201 (= G194), I206 (= I199), W322 (vs. gap), E413 (= E420), H414 (= H421), N450 (= N457)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R323), H369 (= H373), H376 (= H380), H414 (= H421)
- binding manganese (ii) ion: H369 (= H373), H376 (= H380), E413 (= E420)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
32% identity, 99% coverage: 1:462/466 of query aligns to 9:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ Y24), P68 (= P60), G70 (= G62), T71 (≠ G63), G72 (≠ N64), T73 (= T65), G74 (≠ S66), G78 (= G70), V79 (≠ A71), L90 (= L84), P132 (≠ I126), G133 (= G127), A134 (≠ S128), G140 (= G136), M141 (≠ N137), A143 (= A139), T144 (= T140), A146 (= A142), S147 (≠ G143), E200 (= E193), G201 (= G194), I206 (= I199), W323 (vs. gap), E414 (= E420), H415 (= H421), N451 (= N457)
- binding manganese (ii) ion: H370 (= H373), H377 (= H380), E414 (= E420)
- binding pyruvic acid: R319 (= R323), H370 (= H373), H377 (= H380), H415 (= H421)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
31% identity, 99% coverage: 1:462/466 of query aligns to 9:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R323), H369 (= H373), H376 (= H380), H414 (= H421)
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ G63), G72 (≠ N64), T73 (= T65), G74 (≠ S66), G78 (= G70), V79 (≠ A71), L90 (= L84), P132 (≠ I126), G133 (= G127), A134 (≠ S128), G140 (= G136), M141 (≠ N137), A143 (= A139), T144 (= T140), A146 (= A142), S147 (≠ G143), E200 (= E193), G201 (= G194), I206 (= I199), W322 (vs. gap), E413 (= E420), H414 (= H421), N450 (= N457)
- binding manganese (ii) ion: H369 (= H373), H376 (= H380), E413 (= E420)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
32% identity, 99% coverage: 1:462/466 of query aligns to 9:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ G63), G72 (≠ N64), T73 (= T65), G74 (≠ S66), G78 (= G70), V79 (≠ A71), L90 (= L84), P132 (≠ I126), G133 (= G127), A134 (≠ S128), G140 (= G136), M141 (≠ N137), A143 (= A139), T144 (= T140), A146 (= A142), S147 (≠ G143), E200 (= E193), G201 (= G194), I206 (= I199), H369 (= H373), E413 (= E420), N450 (= N457)
- binding deaminohydroxyvaline: R319 (= R323), H414 (= H421)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
31% identity, 99% coverage: 1:462/466 of query aligns to 9:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ G63), G72 (≠ N64), T73 (= T65), G74 (≠ S66), G78 (= G70), V79 (≠ A71), L90 (= L84), P132 (≠ I126), G133 (= G127), A134 (≠ S128), G140 (= G136), M141 (≠ N137), A143 (= A139), T144 (= T140), A146 (= A142), S147 (≠ G143), E200 (= E193), G201 (= G194), I206 (= I199), Y324 (vs. gap), H370 (= H373), E414 (= E420), N451 (= N457)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R323), W323 (vs. gap), H415 (= H421)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
31% identity, 99% coverage: 1:462/466 of query aligns to 9:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R323), W323 (vs. gap), H370 (= H373), H415 (= H421)
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ G63), G72 (≠ N64), T73 (= T65), G74 (≠ S66), G78 (= G70), V79 (≠ A71), L90 (= L84), P132 (≠ I126), G133 (= G127), A134 (≠ S128), G140 (= G136), M141 (≠ N137), A143 (= A139), T144 (= T140), A146 (= A142), S147 (≠ G143), E200 (= E193), G201 (= G194), I206 (= I199), H370 (= H373), E414 (= E420), N451 (= N457)
Query Sequence
>RR42_RS26635 FitnessBrowser__Cup4G11:RR42_RS26635
MQAIVGAGACLSGDADTESYVTDYRRIYRGKAQVVVMPSTTEQVSQVMAWCHAHDVPVVP
QGGNTSLMGGAVPDDSGTAVLLSLGRMNRVLAVDTINDTMTVQAGVTLNAARTAAEQEQR
LFALRIGSEGSCQIGGNLATNAGGTAVLRYGNMRDLVLGIEAVLPDGRIYSSLRGLRKDN
TGYDLKQLFVGSEGTLGIITAAVLKLMPQPRANAVAFVAVQSPEAAVRLLGVAKQHGGQA
VTAFELISAPALELVLEYLGDVTSPLPARHDWMVLIELTSGGSDESLNATLMEILEAGLA
QELVLDAAVAASLADAQRFWRIREEISDAQTRTGGSIKCDVSVPLSRIAAFIGDASAKVL
ALEPAARMVIYGHMGDGNVHFNPLRPKDRSAADFLGQWYAPISEAVDTLAHAENGSISAE
HGIGVAKRDDLKRYKSPVELELMWQVKRALDPKNLLNPAKMLPRLD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory