Comparing RR42_RS26820 FitnessBrowser__Cup4G11:RR42_RS26820 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
55% identity, 94% coverage: 17:290/291 of query aligns to 4:277/278 of 2ia4B
2vhaA Debp (see paper)
55% identity, 94% coverage: 17:290/291 of query aligns to 3:276/276 of 2vhaA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
56% identity, 85% coverage: 17:263/291 of query aligns to 1:247/503 of 8ovoA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
31% identity, 79% coverage: 29:259/291 of query aligns to 4:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
30% identity, 80% coverage: 29:261/291 of query aligns to 4:225/225 of 4zv2A
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
30% identity, 86% coverage: 17:266/291 of query aligns to 1:241/243 of 5eyfB
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
29% identity, 82% coverage: 21:259/291 of query aligns to 2:228/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
27% identity, 81% coverage: 25:261/291 of query aligns to 6:229/229 of 6svfA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
26% identity, 87% coverage: 13:265/291 of query aligns to 36:282/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
26% identity, 87% coverage: 13:265/291 of query aligns to 35:281/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
26% identity, 87% coverage: 13:265/291 of query aligns to 35:281/287 of 6h1uA
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
28% identity, 81% coverage: 21:257/291 of query aligns to 3:229/247 of 2yjpA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
29% identity, 79% coverage: 31:261/291 of query aligns to 3:222/231 of 2q2cA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
26% identity, 79% coverage: 30:260/291 of query aligns to 7:228/228 of 2y7iA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
29% identity, 79% coverage: 31:261/291 of query aligns to 7:226/235 of 2pvuA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
29% identity, 79% coverage: 31:261/291 of query aligns to 13:232/241 of 2q2aA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
27% identity, 79% coverage: 27:257/291 of query aligns to 12:228/235 of 4g4pA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
23% identity, 80% coverage: 29:261/291 of query aligns to 1:224/224 of 4ymxA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
26% identity, 89% coverage: 2:259/291 of query aligns to 8:253/260 of P02911
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
24% identity, 81% coverage: 25:259/291 of query aligns to 4:231/237 of 4i62A
>RR42_RS26820 FitnessBrowser__Cup4G11:RR42_RS26820
MLGATLGMGAVQASDVAASPTLARIKESGTITIGHRTTSIPFSYYDSNQKVIGYSQDICD
KVVAEVKKQAGLSRLDVRMVPVTSQNRISLVQNGTVDLECGVTTNLKARQQQVAFSTTFF
VAGTRLLVKRGGPVHDFPDLSGKTVVTNAGTTSERILRKLNDDKKANITIQSAKDYGESF
LILQSGRVSAFMMDDVLLSGAKTLAPNPAQWEVVGTPQSFEAYGFMMRKDDPEFKKLVDG
VITGLMKSGEIKGLYDKWFSKPVPPKNINFEFPMSAAVKKAYDQPSDEAFE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory