Comparing RR42_RS26850 FitnessBrowser__Cup4G11:RR42_RS26850 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
37% identity, 95% coverage: 15:438/447 of query aligns to 36:456/460 of 5kr6B
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
38% identity, 96% coverage: 10:439/447 of query aligns to 28:447/448 of 6io1B
Sites not aligning to the query:
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
36% identity, 96% coverage: 6:434/447 of query aligns to 21:442/447 of 5lhaA
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
36% identity, 96% coverage: 6:434/447 of query aligns to 23:444/449 of 5lh9D
3gjuA Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
34% identity, 98% coverage: 2:439/447 of query aligns to 26:457/458 of 3gjuA
Sites not aligning to the query:
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
33% identity, 95% coverage: 15:438/447 of query aligns to 72:491/504 of Q94CE5
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
37% identity, 93% coverage: 19:432/447 of query aligns to 32:439/453 of 6g4dB
Sites not aligning to the query:
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
37% identity, 93% coverage: 19:432/447 of query aligns to 32:439/451 of 6g4fA
Sites not aligning to the query:
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
37% identity, 93% coverage: 19:432/447 of query aligns to 32:439/451 of 6g4eA
Sites not aligning to the query:
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 93% coverage: 15:428/447 of query aligns to 32:442/455 of 5kr5A
Sites not aligning to the query:
5ghgB Transaminase w58l with smba
36% identity, 94% coverage: 19:438/447 of query aligns to 33:427/433 of 5ghgB
Sites not aligning to the query:
6s54A Transaminase from pseudomonas fluorescens (see paper)
34% identity, 96% coverage: 2:429/447 of query aligns to 14:442/453 of 6s54A
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
36% identity, 95% coverage: 15:438/447 of query aligns to 34:454/459 of 5kquC
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
34% identity, 93% coverage: 15:428/447 of query aligns to 35:443/458 of 5kr3A
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
34% identity, 94% coverage: 21:439/447 of query aligns to 41:457/458 of 3fcrA
Sites not aligning to the query:
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
33% identity, 93% coverage: 20:436/447 of query aligns to 34:445/459 of D6R3B6
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
34% identity, 93% coverage: 15:429/447 of query aligns to 31:436/450 of 6gwiB
Sites not aligning to the query:
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
32% identity, 97% coverage: 5:438/447 of query aligns to 23:443/448 of 3du4A
Sites not aligning to the query:
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
32% identity, 97% coverage: 5:438/447 of query aligns to 23:443/448 of P53555
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
31% identity, 94% coverage: 19:436/447 of query aligns to 34:434/438 of 6zhkA
Sites not aligning to the query:
>RR42_RS26850 FitnessBrowser__Cup4G11:RR42_RS26850
MTHVFHRNPRQTLAVAVAGKGIELVDSNGKHYIDASGGAAVSCLGHGHPRVIEAIKQQAD
SLAYAHTSFFTTEVSEELARTLAQAAPGDLNHVYFVSGGSEAVEAALKLARQYFVEIGQT
QRRHFIARRQSYHGNTLGALAIGGNAWRREPFLPLLVPAHHVAPCYAYRDQEAGETDQQY
AQRLADELEAKILELGPHSVAAFVAETVVGATAGAVPPVADYLRRVRAVCDKYGVLLILD
EIMSGMGRTGYLFACEEDGVVPDIVTIAKGLAAGYQPIGAMISSSRIYDAVVGGSGFFQH
GHTYIGHATACAAALAVQRTIAEDCLLENVLARGGQLRARLRETLGDHPNVGDIRGRGLF
VGVEFVAERETKATLDPALKMHARLKSTAMQNGLLIYPMGGTVDGMRGDHVLFAPPFICS
AQDIDRIVERFAASVQAVMPATRGALA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory