Comparing RR42_RS27085 FitnessBrowser__Cup4G11:RR42_RS27085 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6vpbB A novel membrane-bound 6-phosphogluconate dehydrogenase from the acetic acid bacteria gluconacetobacter diazotrophicus (gd6pgd) (see paper)
63% identity, 98% coverage: 1:317/322 of query aligns to 1:324/324 of 6vpbB
8i4qA Crystal structure of 6-phosphogluconate dehydrogenase from corynebacterium glutamicum (see paper)
37% identity, 92% coverage: 2:296/322 of query aligns to 4:287/479 of 8i4qA
2w90B Geobacillus stearothermophilus 6-phosphogluconate dehydrogenase with bound 6- phosphogluconate (see paper)
36% identity, 93% coverage: 2:299/322 of query aligns to 7:292/471 of 2w90B
Sites not aligning to the query:
P96789 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Lactococcus lactis subsp. cremoris (strain MG1363) (see paper)
32% identity, 99% coverage: 2:319/322 of query aligns to 5:314/472 of P96789
Sites not aligning to the query:
2iypA Product rup (see paper)
32% identity, 99% coverage: 2:319/322 of query aligns to 5:314/469 of 2iypA
2iyoA Structural characterization of a bacterial 6pdh reveals aspects of specificity, mechanism and mode of inhibition (see paper)
32% identity, 99% coverage: 2:319/322 of query aligns to 5:314/470 of 2iyoA
Sites not aligning to the query:
2iypB Product rup (see paper)
32% identity, 99% coverage: 2:319/322 of query aligns to 6:315/470 of 2iypB
Sites not aligning to the query:
2iz1B 6pdh complexed with pex inhibitor synchrotron data (see paper)
32% identity, 99% coverage: 2:319/322 of query aligns to 7:316/471 of 2iz1B
Sites not aligning to the query:
7cb2A The 6-phosphogluconate dehydrogenase (NADP-bound) from staphylococcus aureus
33% identity, 99% coverage: 2:319/322 of query aligns to 4:311/466 of 7cb2A
7cb5B The 6-phosphogluconate dehydrogenase from staphylococcus aureus (6- phosphogluconate bound) (see paper)
33% identity, 99% coverage: 2:319/322 of query aligns to 4:311/467 of 7cb5B
Sites not aligning to the query:
2zydA Dimeric 6-phosphogluconate dehydrogenase complexed with glucose (see paper)
34% identity, 93% coverage: 2:299/322 of query aligns to 3:288/464 of 2zydA
Sites not aligning to the query:
3fwnB Dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate (see paper)
33% identity, 93% coverage: 2:299/322 of query aligns to 4:289/467 of 3fwnB
Sites not aligning to the query:
3fwnA Dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate (see paper)
33% identity, 93% coverage: 2:299/322 of query aligns to 4:289/467 of 3fwnA
Sites not aligning to the query:
P00350 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Escherichia coli (strain K12) (see paper)
34% identity, 93% coverage: 2:299/322 of query aligns to 5:290/468 of P00350
P78812 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
37% identity, 92% coverage: 3:299/322 of query aligns to 9:294/492 of P78812
2p4qA Crystal structure analysis of gnd1 in saccharomyces cerevisiae (see paper)
34% identity, 92% coverage: 3:299/322 of query aligns to 5:289/476 of 2p4qA
Sites not aligning to the query:
P52209 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Homo sapiens (Human)
33% identity, 98% coverage: 3:319/322 of query aligns to 6:314/483 of P52209
Sites not aligning to the query:
6fqzA Plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor NADP+ and in complex with its substrate 6-phosphogluconate (see paper)
28% identity, 91% coverage: 3:296/322 of query aligns to 4:287/468 of 6fqzA
Sites not aligning to the query:
6fqyA Plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor NADP+ and in complex with its substrate 6-phosphogluconate (see paper)
28% identity, 91% coverage: 3:296/322 of query aligns to 4:287/468 of 6fqyA
2jkvA Structure of human phosphogluconate dehydrogenase in complex with NADPH at 2.53a
33% identity, 98% coverage: 3:319/322 of query aligns to 5:313/482 of 2jkvA
Sites not aligning to the query:
>RR42_RS27085 FitnessBrowser__Cup4G11:RR42_RS27085
MQLGIIGLGRMGANIARRLLRAQHEVVVYNRSADKVQALAADGAVGVTSIEALVGELAAP
RAIWVMLPAGDTTEQMIATLADLLEPGDVIIDGGNTFYKDDIRRAGELAARQLHYVDVGT
SGGVWGLERGYCLMIGGRQEVVGRLDPLFDTLAPGYGDIPRTPGRNPANDRAERGYIHAG
PAGAGHFVKMVHNGIEYGLMQAYAEGFDILKTKAAESLPEAERFALDLADIAEVWRRGSV
VSSWLLDLTAQALASDVKLSRFSGEVADSGEGRWTIDAAVEQAVPVPVLASALFARFRSR
QDHTYGERLLSAMRFGFGGHVE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory