Comparing RR42_RS27205 FitnessBrowser__Cup4G11:RR42_RS27205 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
5cgzA Crystal structure of galb, the 4-carboxy-2-hydroxymuconate hydratase, from pseuodomonas putida kt2440 (see paper)
66% identity, 94% coverage: 16:249/249 of query aligns to 3:240/240 of 5cgzA
6ullA Bshb from bacillus subtilis complexed with a substrate analogue (see paper)
26% identity, 89% coverage: 17:237/249 of query aligns to 4:217/231 of 6ullA
6p2tA Bshb from bacillus subtilis complexed with citrate (see paper)
26% identity, 89% coverage: 17:237/249 of query aligns to 4:217/232 of 6p2tA
Q81ST8 N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1; GlcNAc-Mal deacetylase 1; EC 3.5.1.- from Bacillus anthracis (see paper)
27% identity, 89% coverage: 17:237/249 of query aligns to 6:217/234 of Q81ST8
Q81FP2 N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1; GlcNAc-Mal deacetylase 1; B.cereus zinc-binding protein; BcZBP; EC 3.5.1.- from Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) (see 2 papers)
26% identity, 89% coverage: 17:237/249 of query aligns to 6:217/234 of Q81FP2
2ixdA Crystal structure of the putative deacetylase bc1534 from bacillus cereus (see paper)
26% identity, 89% coverage: 17:237/249 of query aligns to 5:216/232 of 2ixdA
>RR42_RS27205 FitnessBrowser__Cup4G11:RR42_RS27205
MSDIQAQAQPDAQRPSILVVSAHAADFVWRAGGAIALYAERGYNVKIVCLSFGERGESAK
MWRQPGMTIERVKAARHEEAQQAADILGATLECFDLGDYPMRVTDAALLRLADLYRALRP
ELVLSHSREDIYNFDHPLATHVAQEARVIAQAHGYKPEVPVIGAPPVFLFEPHQPEQCNW
KPDVLLDISSVWEKKQRAFATMAAQEHLWEYYTRVALQRGAQAARNSDRKVQYAEGYARV
FPQVAQSLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory