SitesBLAST
Comparing RR42_RS27350 FitnessBrowser__Cup4G11:RR42_RS27350 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
39% identity, 99% coverage: 3:482/486 of query aligns to 1:479/490 of Q9HTJ1
- GAWN 150:153 (≠ SPWN 153:156) binding
- K162 (= K165) active site, Charge relay system
- KPSE 176:179 (≠ KPSS 179:182) binding
- G209 (≠ A212) binding
- GTST 230:233 (≠ STAA 233:236) binding
- E252 (= E253) active site, Proton acceptor
- C286 (= C287) binding covalent; modified: Cysteine sulfenic acid (-SOH)
- E387 (= E387) binding
- E464 (= E467) active site, Charge relay system
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
40% identity, 99% coverage: 4:482/486 of query aligns to 1:478/489 of 4cazA
- active site: N152 (= N156), K175 (= K179), E251 (= E253), C285 (= C287), E386 (= E387), E463 (= E467)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (= I152), G149 (≠ S153), W151 (= W155), N152 (= N156), K175 (= K179), E178 (≠ S182), G208 (≠ A212), G212 (= G216), F226 (= F230), T227 (= T231), G228 (= G232), G229 (≠ S233), T232 (≠ A236), V236 (≠ I240), E251 (= E253), L252 (= L254), C285 (= C287), E386 (= E387), F388 (= F389)
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
40% identity, 99% coverage: 4:482/486 of query aligns to 1:478/489 of 2woxA
- active site: N152 (= N156), K175 (= K179), E251 (= E253), C285 (= C287), E386 (= E387), E463 (= E467)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I148 (= I152), G149 (≠ S153), W151 (= W155), N152 (= N156), K175 (= K179), S177 (= S181), E178 (≠ S182), G208 (≠ A212), G212 (= G216), F226 (= F230), T227 (= T231), G228 (= G232), G229 (≠ S233), T232 (≠ A236), V236 (≠ I240), E251 (= E253), L252 (= L254), C285 (= C287), E386 (= E387), F388 (= F389)
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
40% identity, 99% coverage: 4:482/486 of query aligns to 1:478/489 of 2wmeA
- active site: N152 (= N156), K175 (= K179), E251 (= E253), C285 (= C287), E386 (= E387), E463 (= E467)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (≠ S153), W151 (= W155), K175 (= K179), S177 (= S181), E178 (≠ S182), G208 (≠ A212), G212 (= G216), F226 (= F230), G228 (= G232), G229 (≠ S233), T232 (≠ A236), V236 (≠ I240)
8skfA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (lattice translocation disorder)
39% identity, 99% coverage: 3:482/486 of query aligns to 8:486/497 of 8skfA
- binding calcium ion: T33 (≠ N28), I34 (≠ V29), D100 (≠ E96), V187 (≠ D183)
- binding nicotinamide-adenine-dinucleotide: I156 (= I152), G157 (≠ S153), A158 (≠ P154), W159 (= W155), K183 (= K179), E186 (≠ S182), G216 (≠ A212), G220 (= G216), T235 (= T231), G236 (= G232), G237 (≠ S233), S240 (≠ A236), K243 (≠ H239), E259 (= E253), C293 (= C287), F396 (= F389)
8vr1A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (ctp bound)
39% identity, 97% coverage: 12:482/486 of query aligns to 8:477/488 of 8vr1A
8vr0A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (gmp bound)
39% identity, 97% coverage: 12:482/486 of query aligns to 8:477/488 of 8vr0A
8vqzA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (cmp bound)
39% identity, 97% coverage: 12:482/486 of query aligns to 8:477/488 of 8vqzA
8vqwC Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (coa bound)
39% identity, 97% coverage: 12:482/486 of query aligns to 8:477/488 of 8vqwC
- binding coenzyme a: I147 (= I152), W150 (= W155), K174 (= K179), S176 (= S181), E177 (≠ S182), G207 (≠ A212), G211 (= G216), F225 (= F230), G227 (= G232), G228 (≠ S233), S231 (≠ A236), H331 (≠ Q334), F387 (= F389)
8vj3A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (fad bound)
39% identity, 97% coverage: 12:482/486 of query aligns to 8:477/488 of 8vj3A
8uzoA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (adp bound)
39% identity, 97% coverage: 12:482/486 of query aligns to 8:477/488 of 8uzoA
8uznA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (amp bound)
39% identity, 97% coverage: 12:482/486 of query aligns to 8:477/488 of 8uznA
- binding adenosine monophosphate: I147 (= I152), G148 (≠ S153), K174 (= K179), S176 (= S181), E177 (≠ S182), G207 (≠ A212), G211 (= G216), F225 (= F230), G228 (≠ S233), S231 (≠ A236), K234 (≠ H239)
8uzmA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADPH bound)
39% identity, 97% coverage: 12:482/486 of query aligns to 8:477/488 of 8uzmA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G148 (≠ S153), W150 (= W155), K174 (= K179), S176 (= S181), E177 (≠ S182), G207 (≠ A212), G211 (= G216), F225 (= F230), T226 (= T231), G227 (= G232), G228 (≠ S233), S231 (≠ A236), E250 (= E253), G252 (= G255), C284 (= C287), E385 (= E387), F387 (= F389)
8uzkA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADP+ bound)
39% identity, 97% coverage: 12:482/486 of query aligns to 8:477/488 of 8uzkA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I147 (= I152), G148 (≠ S153), W150 (= W155), N151 (= N156), K174 (= K179), S176 (= S181), E177 (≠ S182), G207 (≠ A212), G211 (= G216), F225 (= F230), G227 (= G232), G228 (≠ S233), S231 (≠ A236), E250 (= E253), F387 (= F389)
5gtlA NADPH complex structure of aldehyde dehydrogenase from bacillus cereus
38% identity, 98% coverage: 6:483/486 of query aligns to 14:487/491 of 5gtlA
- active site: N165 (= N156), K188 (= K179), E263 (= E253), C297 (= C287), E394 (= E387), E471 (= E467)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I161 (= I152), P163 (= P154), K188 (= K179), A190 (≠ S181), E191 (≠ S182), Q192 (≠ D183), G221 (≠ A212), G225 (= G216), G241 (= G232), S242 (= S233), T245 (≠ A236), L264 (= L254), C297 (= C287), E394 (= E387), F396 (= F389)
5gtkA NAD+ complex structure of aldehyde dehydrogenase from bacillus cereus
38% identity, 98% coverage: 6:483/486 of query aligns to 14:487/491 of 5gtkA
- active site: N165 (= N156), K188 (= K179), E263 (= E253), C297 (= C287), E394 (= E387), E471 (= E467)
- binding nicotinamide-adenine-dinucleotide: I161 (= I152), I162 (≠ S153), P163 (= P154), W164 (= W155), K188 (= K179), E191 (≠ S182), G221 (≠ A212), G225 (= G216), A226 (= A217), F239 (= F230), G241 (= G232), S242 (= S233), T245 (≠ A236), Y248 (≠ H239), L264 (= L254), C297 (= C287), Q344 (= Q334), R347 (≠ T337), E394 (= E387), F396 (= F389)
6wsbA Crystal structure of a betaine aldehyde dehydrogenase from burkholderia pseudomallei bound to cofactor NAD (see paper)
41% identity, 97% coverage: 12:482/486 of query aligns to 9:477/489 of 6wsbA
- active site: N152 (= N156), E250 (= E253), C284 (= C287), E462 (= E467)
- binding nicotinamide-adenine-dinucleotide: I148 (= I152), G149 (≠ S153), A150 (≠ P154), W151 (= W155), N152 (= N156), K175 (= K179), E178 (≠ S182), G208 (= G213), G211 (= G216), A212 (= A217), F225 (= F230), T226 (= T231), G227 (= G232), G228 (≠ S233), T231 (≠ A236), V235 (≠ I240), E250 (= E253), L251 (= L254), G252 (= G255), C284 (= C287), E385 (= E387), F387 (= F389)
7radA Crystal structure analysis of aldh1b1
38% identity, 97% coverage: 12:482/486 of query aligns to 16:484/493 of 7radA
- binding nicotinamide-adenine-dinucleotide: I158 (= I152), I159 (≠ S153), P160 (= P154), W161 (= W155), N162 (= N156), M167 (≠ I161), K185 (= K179), E188 (≠ S182), G218 (≠ A212), G222 (= G216), A223 (= A217), T237 (= T231), G238 (= G232), S239 (= S233), V242 (≠ A236), E261 (= E253), L262 (= L254), C295 (= C287), E392 (= E387), F394 (= F389)
- binding 3-(2-methoxyphenyl)-1-(4-phenylphenyl)-6,7,8,9-tetrahydro-5~{H}-imidazo[1,2-a][1,3]diazepine: L113 (= L103), E117 (= E107), F163 (= F157), E285 (≠ K277), F289 (≠ S281), N450 (= N448), V452 (≠ I450)
7mjdA Crystal structure analysis of aldh1b1
38% identity, 97% coverage: 12:482/486 of query aligns to 16:484/493 of 7mjdA
- binding nicotinamide-adenine-dinucleotide: I158 (= I152), I159 (≠ S153), P160 (= P154), W161 (= W155), N162 (= N156), M167 (≠ I161), K185 (= K179), E188 (≠ S182), G218 (≠ A212), G222 (= G216), F236 (= F230), T237 (= T231), G238 (= G232), S239 (= S233), V242 (≠ A236), E261 (= E253), L262 (= L254), C295 (= C287), E392 (= E387), F394 (= F389)
- binding 8-(2-methoxyphenyl)-10-(4-phenylphenyl)-1$l^{4},8-diazabicyclo[5.3.0]deca-1(7),9-diene: E117 (= E107), E285 (≠ K277), F289 (≠ S281), N450 (= N448), V452 (≠ I450)
7mjcA Crystal structure analysis of aldh1b1
38% identity, 97% coverage: 12:482/486 of query aligns to 16:484/493 of 7mjcA
- binding nicotinamide-adenine-dinucleotide: I158 (= I152), I159 (≠ S153), P160 (= P154), W161 (= W155), N162 (= N156), K185 (= K179), E188 (≠ S182), G218 (≠ A212), G222 (= G216), T237 (= T231), G238 (= G232), S239 (= S233), V242 (≠ A236), E261 (= E253), L262 (= L254), C295 (= C287), E392 (= E387), F394 (= F389)
Query Sequence
>RR42_RS27350 FitnessBrowser__Cup4G11:RR42_RS27350
MAVAKTDEFNNYINGEWSKSASGRTFDNVNPADTADIVGRFQASTADDAQAAVAAAAAAF
DAWKKTPISKRAKILNGAADYLEANAEQIAEELTREEGKALNLSKDEVLRSAQTIRFYAV
EGQSFSGETYPQDDPDMIVYSQREPLGVVTVISPWNFPVSIPARKIAPALIAGNTVVFKP
SSDAPLSGYRLAQAFVEAGIPKGVLNFITGRAGDVGAAITEAPAVRAISFTGSTAAGQHI
HRSVSLSTRTQMELGGKNPLIVMEDADLDRAVDLTIKGGLSLSGQACTGTSRVLVMASVK
AAYTEKLLAKVKTLKIGSGMTPGMDVGPLATRKQLETVLGYVEAGKSEATHLCGGDRLGG
EPYDKGFYVSPAVFTGVTQQMRIAREEIFGPVIAIIEVSSYADAIAKANDTEYGLSAAIV
TSNPRYAHDFAHDIQSGTVKINRTTTGNLINAPFGGLKQSSTSTFRESGRAGLEFYTQIK
TVYRGC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory