Comparing RR42_RS27360 FitnessBrowser__Cup4G11:RR42_RS27360 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
32% identity, 93% coverage: 20:328/332 of query aligns to 23:335/337 of 1krhA
Sites not aligning to the query:
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
33% identity, 95% coverage: 12:328/332 of query aligns to 10:331/334 of P0DPQ8
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
33% identity, 95% coverage: 12:328/332 of query aligns to 9:330/333 of 5ogxA
Sites not aligning to the query:
Q03304 Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component; T4MO; Ferredoxin--NAD(+) reductase; Toluene-4-monooxygenase systme, electron transfer component; EC 1.18.1.3 from Pseudomonas mendocina (see paper)
28% identity, 90% coverage: 14:313/332 of query aligns to 13:310/326 of Q03304
4wqmA Structure of the toluene 4-monooxygenase nadh oxidoreductase t4mof, k270s k271s variant (see paper)
27% identity, 94% coverage: 2:313/332 of query aligns to 1:310/326 of 4wqmA
Sites not aligning to the query:
7c3bC Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
29% identity, 96% coverage: 8:327/332 of query aligns to 11:333/334 of 7c3bC
7c3aA Ferredoxin reductase in carbazole 1,9a-dioxygenase (see paper)
28% identity, 96% coverage: 8:327/332 of query aligns to 10:320/321 of 7c3aA
Sites not aligning to the query:
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
27% identity, 61% coverage: 127:327/332 of query aligns to 41:244/250 of 1tvcA
Sites not aligning to the query:
7c3bB Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
27% identity, 96% coverage: 8:327/332 of query aligns to 10:305/306 of 7c3bB
7romA Crystal structure of saccharomyces cerevisiae nadh-cytochrome b5 reductase 1 (cbr1) fragment (residues 28-284) bound to fad
28% identity, 55% coverage: 133:316/332 of query aligns to 45:238/255 of 7romA
7qu3A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
23% identity, 64% coverage: 115:327/332 of query aligns to 20:278/279 of 7qu3A
7qu5A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
23% identity, 64% coverage: 115:327/332 of query aligns to 20:278/280 of 7qu5A
Sites not aligning to the query:
4itkA The structure of c.Reinhardtii ferredoxin 2 (see paper)
40% identity, 24% coverage: 9:88/332 of query aligns to 10:88/104 of 4itkA
3fpkA Crystal structure of ferredoxin-NADP reductase from salmonella typhimurium
26% identity, 63% coverage: 102:310/332 of query aligns to 5:222/247 of 3fpkA
Sites not aligning to the query:
Q8IED5 Ferredoxin, apicoplast from Plasmodium falciparum (isolate 3D7) (see paper)
36% identity, 25% coverage: 11:93/332 of query aligns to 109:190/194 of Q8IED5
6iriA Crystal structure of the minor ferredoxin from thermosynechococcus elongatus (see paper)
37% identity, 26% coverage: 3:88/332 of query aligns to 9:97/107 of 6iriA
8dosA Crystal structure of ferredoxin (flavodoxin):nadp(+) oxidoreductase from klebsiella pneumoniae
27% identity, 56% coverage: 124:310/332 of query aligns to 24:222/247 of 8dosA
Sites not aligning to the query:
3ab5A Crystal structure of the 2fe 2s ferredoxin from cyanidioschyzon merolae
37% identity, 26% coverage: 3:88/332 of query aligns to 2:90/97 of 3ab5A
1iueA Crystal structure analysis of ferredoxin from plasmodium falciparum
35% identity, 26% coverage: 9:93/332 of query aligns to 11:94/98 of 1iueA
5ufaA Crystal structure of a ferredoxin NADP+ reductase from neisseria gonorrhoeae with bound fad and NADP
26% identity, 60% coverage: 118:316/332 of query aligns to 20:228/246 of 5ufaA
Sites not aligning to the query:
>RR42_RS27360 FitnessBrowser__Cup4G11:RR42_RS27360
MSYRIHLIESQQSFDVDADESVLDGALRANVQMAHDCRFGGCATCRVRLVEGAVAYDEYP
MGLTPEEEAEGFALACQARPTSDLVISTARPGEPCAEPARHTAVIRKIAPLSADVVHLTL
ELPQAPALDYRPGQYLKIFTGDGIARSFSMASVPRDRTVDLHVRRIPGGYFTERLLAGLR
SDDQLDVELPLGGFYFRKDDYRPLVMVATGTGLAPIKSILESLMDDPDCPPVSLYWGMRT
QADLYLHEQIQAWGARLYDFQYVPVLSRADGAWSGRRGHVQHAVAADLPDLSEHAIYLCG
SPDMICDARETFLGLGASGAHIYADSFTFQHR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory