SitesBLAST
Comparing RR42_RS27410 FitnessBrowser__Cup4G11:RR42_RS27410 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
42% identity, 92% coverage: 26:319/319 of query aligns to 20:315/315 of 5vg6B
- active site: M98 (= M100), R230 (= R234), D254 (= D258), E259 (= E263), H278 (= H282)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A74 (= A75), R92 (= R94), M102 (= M104), L147 (= L149), G148 (= G150), D149 (≠ T151), L150 (= L152), W168 (= W170), S169 (= S171), R170 (= R172), T171 (≠ S173), K173 (= K175), L201 (= L205), P202 (= P206), T207 (= T211), V228 (= V232), R230 (= R234), H278 (= H282), A280 (= A284), S281 (≠ A285), Y315 (= Y319)
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
39% identity, 97% coverage: 11:319/319 of query aligns to 4:313/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A66 (= A75), R90 (= R94), M100 (= M104), A145 (≠ L149), G146 (= G150), V147 (≠ T151), L148 (= L152), W166 (= W170), S167 (= S171), R168 (= R172), T169 (≠ S173), K171 (= K175), L199 (= L205), P200 (= P206), L226 (≠ V232), A227 (≠ G233), R228 (= R234), D252 (= D258), H276 (= H282), A279 (= A285), Y313 (= Y319)
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
39% identity, 97% coverage: 11:319/319 of query aligns to 3:312/312 of 7jqiA
- binding 2-oxoglutaric acid: G64 (= G74), A65 (= A75), G66 (= G76), R227 (= R234), H275 (= H282)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A75), R89 (= R94), M99 (= M104), A144 (≠ L149), G145 (= G150), V146 (≠ T151), L147 (= L152), W165 (= W170), S166 (= S171), R167 (= R172), T168 (≠ S173), K170 (= K175), L198 (= L205), P199 (= P206), L225 (≠ V232), R227 (= R234), H275 (= H282), A278 (= A285), Y312 (= Y319)
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
39% identity, 97% coverage: 11:319/319 of query aligns to 3:312/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A75), R89 (= R94), M99 (= M104), A144 (≠ L149), G145 (= G150), V146 (≠ T151), L147 (= L152), W165 (= W170), S166 (= S171), R167 (= R172), T168 (≠ S173), K170 (= K175), L198 (= L205), P199 (= P206), L225 (≠ V232), R227 (= R234), H275 (= H282), A277 (= A284), A278 (= A285), Y312 (= Y319)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: F10 (≠ L18), D11 (= D19), W15 (≠ L23), A65 (= A75), R227 (= R234), H275 (= H282), T280 (= T287)
4z0pA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
41% identity, 86% coverage: 45:319/319 of query aligns to 41:316/316 of 4z0pA
- active site: L95 (≠ M100), R231 (= R234), G250 (= G253), D255 (= D258), E260 (= E263), H279 (= H282)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R94), M99 (= M104), M144 (≠ L149), G145 (= G150), V146 (≠ T151), L147 (= L152), W165 (= W170), S166 (= S171), R167 (= R172), S168 (= S173), R170 (≠ K175), L197 (= L205), P198 (= P206), A229 (≠ V232), G230 (= G233), R231 (= R234), H279 (= H282), A281 (= A284), A282 (= A285), Y316 (= Y319)
- binding oxalic acid: W50 (= W54), G70 (= G74), A71 (= A75), G72 (= G76), H114 (≠ M119), R115 (≠ G120), R231 (= R234), H279 (= H282)
4weqA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADP and sulfate (see paper)
41% identity, 86% coverage: 45:319/319 of query aligns to 41:316/316 of 4weqA
- active site: L95 (≠ M100), R231 (= R234), G250 (= G253), D255 (= D258), E260 (= E263), H279 (= H282)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R89 (= R94), M99 (= M104), M144 (≠ L149), G145 (= G150), V146 (≠ T151), L147 (= L152), W165 (= W170), S166 (= S171), R167 (= R172), S168 (= S173), R170 (≠ K175), L197 (= L205), P198 (= P206), A229 (≠ V232), G230 (= G233), R231 (= R234), D255 (= D258), H279 (= H282), A281 (= A284), Y316 (= Y319)
3kboA 2.14 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium in complex with NADP
39% identity, 93% coverage: 22:319/319 of query aligns to 14:312/312 of 3kboA
- active site: M95 (= M100), R227 (= R234), E256 (= E263), H275 (= H282)
- binding N-(2-hydroxyethyl)-N,N-dimethyl-3-sulfopropan-1-aminium: N36 (≠ L45), A53 (= A62), R55 (≠ M64), R56 (≠ K66)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R94), M99 (= M104), G143 (= G148), A144 (≠ L149), G145 (= G150), V146 (≠ T151), L147 (= L152), W165 (= W170), S166 (= S171), R167 (= R172), S168 (= S173), K170 (= K175), L197 (= L204), P199 (= P206), L225 (≠ V232), A226 (≠ G233), R227 (= R234), D251 (= D258), H275 (= H282), A278 (= A285), Y312 (= Y319)
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
41% identity, 86% coverage: 47:319/319 of query aligns to 47:316/316 of 4zqbB
- active site: L99 (≠ M100), R231 (= R234), E260 (= E263), H279 (= H282)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (= R94), M103 (= M104), G147 (= G148), L148 (= L149), G149 (= G150), E150 (≠ T151), L151 (= L152), W169 (= W170), S170 (= S171), R171 (= R172), S172 (= S173), K174 (= K175), L202 (= L205), P203 (= P206), F229 (≠ V232), R231 (= R234), H279 (= H282), S281 (≠ A284), A282 (= A285), Y316 (= Y319)
5tsdA Crystal structure of NADPH-dependent 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH and oxalate
35% identity, 86% coverage: 45:319/319 of query aligns to 41:316/316 of 5tsdA
- active site: E260 (= E263), H279 (= H282)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A71 (= A75), R89 (= R94), M99 (= M104), G143 (= G148), L144 (= L149), G145 (= G150), I146 (≠ T151), L147 (= L152), W165 (= W170), S166 (= S171), R167 (= R172), T168 (≠ S173), K170 (= K175), L197 (= L205), P198 (= P206), A229 (≠ V232), G230 (= G233), R231 (= R234), D255 (= D258), H279 (= H282), Y316 (= Y319)
- binding oxalic acid: W50 (= W54), G70 (= G74), A71 (= A75), G72 (= G76), R231 (= R234), H279 (= H282)
5bqfA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADP, hepes and l(+)-tartaric acid
35% identity, 86% coverage: 45:319/319 of query aligns to 42:317/317 of 5bqfA
- active site: E261 (= E263), H280 (= H282)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A72 (= A75), R90 (= R94), M100 (= M104), G144 (= G148), L145 (= L149), G146 (= G150), I147 (≠ T151), L148 (= L152), W166 (= W170), S167 (= S171), R168 (= R172), T169 (≠ S173), L198 (= L205), P199 (= P206), A230 (≠ V232), G231 (= G233), R232 (= R234), H280 (= H282), A283 (= A285), Y317 (= Y319)
4xcvA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH
35% identity, 86% coverage: 45:319/319 of query aligns to 42:317/317 of 4xcvA
- active site: E261 (= E263), H280 (= H282)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A72 (= A75), R90 (= R94), M100 (= M104), G144 (= G148), L145 (= L149), G146 (= G150), I147 (≠ T151), L148 (= L152), W166 (= W170), S167 (= S171), R168 (= R172), T169 (≠ S173), K171 (= K175), L198 (= L205), P199 (= P206), A230 (≠ V232), G231 (= G233), R232 (= R234), H280 (= H282), A283 (= A285), Y317 (= Y319)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
33% identity, 62% coverage: 103:301/319 of query aligns to 92:296/306 of 5mh6A
- binding 2-Ketohexanoic acid: R224 (= R234), H272 (= H282), Y280 (vs. gap)
- binding magnesium ion: T130 (≠ V137), A132 (≠ P139), F210 (= F220), E211 (≠ A221), M213 (≠ L223), G225 (= G235), P226 (≠ S236), V228 (≠ L238), E230 (= E240), D241 (≠ T251), S251 (≠ Q261)
- binding nicotinamide-adenine-dinucleotide: G142 (= G150), T143 (= T151), L144 (= L152), R164 (= R172), P196 (= P206), T201 (= T211), V222 (= V232), A223 (≠ G233), R224 (= R234), H272 (= H282), S274 (≠ A284)
Sites not aligning to the query:
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
33% identity, 62% coverage: 103:301/319 of query aligns to 94:298/308 of 5mhaB
- binding 2-Ketohexanoic acid: R226 (= R234), H274 (= H282), Y282 (vs. gap)
- binding (2R)-2-hydroxyhexanoic acid: Y282 (vs. gap)
- binding magnesium ion: F212 (= F220), E213 (≠ A221), M215 (≠ L223), D243 (≠ T251)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L143 (= L149), G144 (= G150), T145 (= T151), L146 (= L152), R165 (≠ S171), R166 (= R172), S167 (= S173), P180 (≠ Q188), T197 (≠ L205), P198 (= P206), T203 (= T211), V224 (= V232), A225 (≠ G233), R226 (= R234), H274 (= H282), S276 (≠ A284)
Sites not aligning to the query:
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
33% identity, 62% coverage: 103:301/319 of query aligns to 94:298/308 of 5mhaA
- binding 2-Ketohexanoic acid: R226 (= R234), H274 (= H282), Y282 (vs. gap)
- binding magnesium ion: T132 (≠ V137), A134 (≠ P139)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L143 (= L149), G144 (= G150), T145 (= T151), L146 (= L152), R165 (≠ S171), R166 (= R172), S167 (= S173), P180 (≠ Q188), T197 (≠ L205), P198 (= P206), T203 (= T211), V224 (= V232), A225 (≠ G233), R226 (= R234), H274 (= H282), S276 (≠ A284)
Sites not aligning to the query:
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
33% identity, 62% coverage: 103:301/319 of query aligns to 94:298/308 of 5mh5A
- binding 2-Ketohexanoic acid: R226 (= R234), H274 (= H282), Y282 (vs. gap)
- binding magnesium ion: T132 (≠ V137), A134 (≠ P139), F212 (= F220), E213 (≠ A221), M215 (≠ L223), D243 (≠ T251)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G142 (= G148), L143 (= L149), G144 (= G150), T145 (= T151), L146 (= L152), R165 (≠ S171), R166 (= R172), S167 (= S173), T197 (≠ L205), P198 (= P206), T203 (= T211), V224 (= V232), A225 (≠ G233), R226 (= R234), H274 (= H282), S276 (≠ A284)
Sites not aligning to the query:
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
30% identity, 78% coverage: 51:300/319 of query aligns to 46:290/318 of 5j23A
- active site: L94 (vs. gap), R228 (= R234), D252 (= D258), E257 (= E263), H275 (= H282)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (≠ A75), L148 (= L149), G149 (= G150), R150 (≠ T151), I151 (≠ L152), T170 (≠ S171), R171 (= R172), P200 (= P206), S204 (≠ Q210), T205 (= T211), R228 (= R234)
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
30% identity, 78% coverage: 51:300/319 of query aligns to 48:292/319 of 5v6qB
- active site: L96 (vs. gap), R230 (= R234), D254 (= D258), E259 (= E263), H277 (= H282)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (≠ A75), V100 (≠ I95), F148 (≠ A147), L150 (= L149), G151 (= G150), R152 (≠ T151), I153 (≠ L152), T172 (≠ S171), R173 (= R172), V201 (≠ L205), P202 (= P206), S206 (≠ Q210), T207 (= T211), V228 (= V232), G229 (= G233), R230 (= R234), H277 (= H282), A279 (= A284)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
30% identity, 78% coverage: 51:300/319 of query aligns to 46:290/317 of 5v7gA
- active site: L94 (vs. gap), R228 (= R234), D252 (= D258), E257 (= E263), H275 (= H282)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (≠ A75), V98 (≠ I95), F146 (≠ A147), L148 (= L149), G149 (= G150), R150 (≠ T151), I151 (≠ L152), T170 (≠ S171), R171 (= R172), V199 (≠ L205), P200 (= P206), S204 (≠ Q210), T205 (= T211), V226 (= V232), G227 (= G233), R228 (= R234), H275 (= H282), A277 (= A284)
- binding oxalate ion: G69 (= G74), V70 (≠ A75), G71 (= G76), R228 (= R234), H275 (= H282)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
30% identity, 78% coverage: 51:300/319 of query aligns to 47:291/319 of 5v7nA
- active site: L95 (vs. gap), R229 (= R234), D253 (= D258), E258 (= E263), H276 (= H282)
- binding 2-keto-D-gluconic acid: G70 (= G74), V71 (≠ A75), G72 (= G76), R229 (= R234), H276 (= H282), S279 (≠ A285), R285 (= R294)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (≠ A75), V99 (≠ I95), L149 (= L149), G150 (= G150), R151 (≠ T151), I152 (≠ L152), T171 (≠ S171), R172 (= R172), V200 (≠ L205), P201 (= P206), S205 (≠ Q210), T206 (= T211), V227 (= V232), G228 (= G233), R229 (= R234), H276 (= H282), A278 (= A284)
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
29% identity, 71% coverage: 62:287/319 of query aligns to 66:294/324 of 2gcgA
- active site: L103 (≠ M100), R241 (= R234), D265 (= D258), E270 (= E263), H289 (= H282)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (≠ G74), V79 (≠ A75), G80 (= G76), R241 (= R234), H289 (= H282)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (≠ A75), T107 (≠ M104), G156 (= G148), G158 (= G150), I160 (≠ L152), G180 (vs. gap), R181 (= R172), R184 (≠ K175), C212 (≠ L205), S213 (≠ P206), T218 (= T211), I239 (≠ V232), R241 (= R234), D265 (= D258), H289 (= H282), G291 (≠ A284)
Sites not aligning to the query:
Query Sequence
>RR42_RS27410 FitnessBrowser__Cup4G11:RR42_RS27410
MDMTTTKPPCVALLSSVLDMQYLVPAFRAAAPGLDLRVGPDLGALDDIDAAVCWAPPPGL
LAAMPKLRLVQSLGAGIDHLRSDPDLPPGPTVCRIVDTAMAGTMTAYVTWAVIQHQRSMG
AYLASAAAGQWQEQPIVAPSRHRVGIAGLGTLGIASARALQAVGYAVRGWSRSPKADLPE
GVQAFHGQDGLDAFLAGCDALVCLLPLTAQTQGFLCADLFARLPRGAHLINVGRGSHLVE
ADLLRALDDGTLGAATLDAFQHEPLPSGHPFWRHPRINVTPHVAARTDPATIARQTLDNL
AQLRRGQRPAVAVDPAQGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory