Comparing RR42_RS27580 FitnessBrowser__Cup4G11:RR42_RS27580 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6umcB Crystal structure of human gac in complex with inhibitor upgl00012
41% identity, 91% coverage: 21:298/304 of query aligns to 108:388/410 of 6umcB
6ujgA Crystal structure of human gac in complex with inhibitor upgl00012
41% identity, 91% coverage: 21:298/304 of query aligns to 108:388/410 of 6ujgA
5wj6A Crystal structure of glutaminasE C in complex with inhibitor 2-phenyl- n-{5-[4-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}amino) piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide (upgl-00004) (see paper)
41% identity, 91% coverage: 21:298/304 of query aligns to 108:388/410 of 5wj6A
5i94A Crystal structure of human glutaminasE C in complex with the inhibitor upgl-00019 (see paper)
41% identity, 91% coverage: 21:298/304 of query aligns to 108:388/410 of 5i94A
6umfA Crystal structure of human gac in complex with inhibitor upgl00012
41% identity, 91% coverage: 21:298/304 of query aligns to 108:388/409 of 6umfA
6uljA Crystal structure of human gac in complex with inhibitor upgl00012
41% identity, 91% coverage: 21:298/304 of query aligns to 108:388/409 of 6uljA
6ulaA Crystal structure of human gac in complex with inhibitor upgl00012
41% identity, 91% coverage: 21:298/304 of query aligns to 108:388/409 of 6ulaA
6ukbA Crystal structure of human gac in complex with inhibitor upgl00012
41% identity, 91% coverage: 21:298/304 of query aligns to 108:388/409 of 6ukbA
6ujmA Crystal structure of human gac in complex with inhibitor upgl00013
41% identity, 91% coverage: 21:298/304 of query aligns to 108:388/409 of 6ujmA
8jubA Crystal structure of glutaminasE C in complex with compound 27 (see paper)
41% identity, 91% coverage: 21:298/304 of query aligns to 100:380/401 of 8jubA
8jueA Crystal structure of glutaminasE C in complex with compound 11 (see paper)
41% identity, 91% coverage: 21:298/304 of query aligns to 101:381/401 of 8jueA
6umdB Crystal structure of human gac in complex with inhibitor upgl00012
41% identity, 91% coverage: 21:298/304 of query aligns to 108:388/409 of 6umdB
6ul9B Crystal structure of human gac in complex with inhibitor upgl00023
41% identity, 91% coverage: 21:298/304 of query aligns to 108:388/409 of 6ul9B
5fi7A Crystal structure of human gac in complex with inhibitor upgl_00015: 2-phenyl-~{n}-[5-[(3~{s})-3-[[5-(2-phenylethanoylamino)-1,3,4- thiadiazol-2-yl]oxy]pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl]ethanamide (see paper)
41% identity, 91% coverage: 21:298/304 of query aligns to 108:388/410 of 5fi7A
5fi6A Crystal structure of human gac in complex with inhibitor upgl_00011: 2-phenyl-~{n}-[5-[[(3~{s})-1-[5-(2-phenylethanoylamino)-1,3,4- thiadiazol-2-yl]pyrrolidin-3-yl]amino]-1,3,4-thiadiazol-2- yl]ethanamide (see paper)
41% identity, 91% coverage: 21:298/304 of query aligns to 108:388/410 of 5fi6A
5fi2A Crystal structure of human gac in complex with inhibitor upgl_00009: 2-phenyl-~{n}-[5-[[(3~{r})-1-[5-(2-phenylethanoylamino)-1,3,4- thiadiazol- 2-yl]pyrrolidin-3-yl]amino]-1,3,4-thiadiazol-2- yl]ethanamide (see paper)
41% identity, 91% coverage: 21:298/304 of query aligns to 108:388/410 of 5fi2A
4o7dA Crystal structure of human glutaminase in complex don (see paper)
41% identity, 91% coverage: 21:298/304 of query aligns to 26:306/313 of 4o7dA
5uqeD Multidomain structure of human kidney-type glutaminase(kga/gls) (see paper)
41% identity, 91% coverage: 21:298/304 of query aligns to 108:388/507 of 5uqeD
6loxA Crystal structure of human glutaminase with macrocyclic inhibitor (see paper)
41% identity, 91% coverage: 21:298/304 of query aligns to 106:386/407 of 6loxA
8gwrB Near full length kidney type glutaminase in complex with 2,2-dimethyl- 2,3-dihydrobenzo[a] phenanthridin-4(1h)-one (ddp) (see paper)
41% identity, 91% coverage: 21:298/304 of query aligns to 101:381/501 of 8gwrB
>RR42_RS27580 FitnessBrowser__Cup4G11:RR42_RS27580
MDYAHILQRIHRDIAPLLTQGRVADYIPELGKVPATHFGMALVFADGRSHCVGDAAVPFS
IQSISKLFACTLAFQLLGEDLWQRVGREPSGNAFNSLVQLEYEQGKPRNPFINAGALVVT
DVLCSRFVQAETAMVQFLRRLSGNPAIDYDPRVAQSEREHADRNRAMAYFMKDFGRLEMP
VDKVIDAYCRQCAITMSCEDLARAALFLAHGGVVPWSGERVLDASPTKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGRWAVCVWSPGLDHSGNSLAGVQALEWLTTLSG
HSIF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory