Comparing RR42_RS27720 FitnessBrowser__Cup4G11:RR42_RS27720 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q9R0W2 Solute carrier family 22 member 2; Organic cation transporter 2; rOCT2 from Rattus norvegicus (Rat) (see paper)
27% identity, 25% coverage: 81:189/440 of query aligns to 162:262/555 of Q9R0W2
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 36% coverage: 81:238/440 of query aligns to 98:262/583 of Q9Y7Q9
Sites not aligning to the query:
Q4U2R8 Solute carrier family 22 member 6; Organic anion transporter 1; hOAT1; PAH transporter; hPAHT; Renal organic anion transporter 1; hROAT1 from Homo sapiens (Human) (see 6 papers)
24% identity, 85% coverage: 67:438/440 of query aligns to 136:512/563 of Q4U2R8
Sites not aligning to the query:
8fvzA Pipt y150a
27% identity, 36% coverage: 24:180/440 of query aligns to 4:156/433 of 8fvzA
Sites not aligning to the query:
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
24% identity, 70% coverage: 81:387/440 of query aligns to 66:409/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
24% identity, 70% coverage: 81:387/440 of query aligns to 66:409/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
24% identity, 70% coverage: 81:387/440 of query aligns to 66:409/475 of 4gbyA
Q9VCA2 Organic cation transporter protein from Drosophila melanogaster (Fruit fly) (see paper)
25% identity, 72% coverage: 81:398/440 of query aligns to 143:474/548 of Q9VCA2
Sites not aligning to the query:
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
24% identity, 70% coverage: 81:387/440 of query aligns to 70:413/491 of P0AGF4
Sites not aligning to the query:
8sc2A Human oct1 bound to diltiazem in inward-open conformation (see paper)
24% identity, 49% coverage: 83:298/440 of query aligns to 140:356/453 of 8sc2A
Sites not aligning to the query:
>RR42_RS27720 FitnessBrowser__Cup4G11:RR42_RS27720
MSTARSAAGTLDAATHAAKPGMGRLAAASTIGTTLEWYDFTVYNLMAALVFNAVFFPSFD
PLTGTILAFSTYAVGYVSRPLGGVLFGHLGDKLGRRFVLVATLILMGVATGLMGVLPTYM
SWGIWSPILLVALRFLQGAAIGGEWAGAVLLSMEHGEQHQRGRNASFTQVGPSCGTLLGT
GFIAVVSLWLSPEDFQAWGWRVPFLSSVLLVLFGLWLRKGVEETPLFKEMEARKSTAKTP
IKEVFVDHWRRLLVAGGVRIGSDVLYALVVVFTLTYVTSVLHLSRPLALSATMIGAACNA
IAVPLFGSLSDKLGRRPVYIAGAVLAVVWAFVFFRLMDSAQPLQICAAVVVGLIIHAMMY
GPQAAFVTEQFPTRVRYAGSSLAYTLAGIVGGGFAPLIIASLYKSYGSTLAISLYVSAAV
ALTLVALLVARETANKPLES
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory