Comparing RR42_RS27930 FitnessBrowser__Cup4G11:RR42_RS27930 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
35% identity, 96% coverage: 11:381/387 of query aligns to 9:372/380 of P54955
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 96% coverage: 15:385/387 of query aligns to 51:423/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 96% coverage: 15:385/387 of query aligns to 55:427/442 of P54968
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
34% identity, 86% coverage: 4:335/387 of query aligns to 11:344/398 of 6slfA
Sites not aligning to the query:
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
29% identity, 100% coverage: 1:386/387 of query aligns to 1:389/389 of 4ewtA
3ramA Crystal structure of hmra (see paper)
25% identity, 70% coverage: 12:281/387 of query aligns to 18:269/391 of 3ramA
Sites not aligning to the query:
>RR42_RS27930 FitnessBrowser__Cup4G11:RR42_RS27930
MPPALTESAKRFAEVRHRIHAHPELGADVPRTAEMAAALLREWGYSVHTLGGHGLVAQLK
VGNGARTIGIRADMDALPLQERTGLPYASQVAGRMHACGHDGHTATLLAAAEYLAATRHF
DGTLNLIFQPDEEGMTGALAMMNDGLFERFPCDAIYAFHNAPGLPVGMAVVQSGPMGGSS
DRATITFRGKGGHGAMPHRATDPTLALASTVVALQGIVARNVAPVDAAVISVGEMQAGST
YNIIPETATLKLSVRATVAEVRDLLETRIREVVTHQAASCGVAVDIAYERLAPAICNTVE
ETAIARQAVASVLGNDKVIQVPPSMQMGSEDFAWMLERMPGCYFALGNGTGEWVGCSVHN
DGYDFNDQLIPLGAACWVALAEGYLRA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory