Comparing RR42_RS28130 FitnessBrowser__Cup4G11:RR42_RS28130 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
3wkiA Crystal structure of cellobiose 2-epimerase in complex with cellobiitol (see paper)
30% identity, 47% coverage: 52:229/379 of query aligns to 46:238/407 of 3wkiA
Sites not aligning to the query:
3wkhA Crystal structure of cellobiose 2-epimerase in complex with epilactose (see paper)
30% identity, 47% coverage: 52:229/379 of query aligns to 46:238/410 of 3wkhA
Sites not aligning to the query:
3wkgA Crystal structure of cellobiose 2-epimerase in complex with glucosylmannose (see paper)
30% identity, 47% coverage: 52:229/379 of query aligns to 46:238/410 of 3wkgA
Sites not aligning to the query:
P0DKY4 Cellobiose 2-epimerase; CE; EC 5.1.3.11 from Ruminococcus albus (see paper)
26% identity, 76% coverage: 82:368/379 of query aligns to 71:374/389 of P0DKY4
Sites not aligning to the query:
7d5gA Crystal structure of the csce with ligand to have a insight into the catalytic mechanism
19% identity, 66% coverage: 22:273/379 of query aligns to 10:273/389 of 7d5gA
Sites not aligning to the query:
8wbvA The crystal structure of linear mannose with mutant h247f of the cellobiose 2-epimerase from caldicellulosiruptor saccharolyticus
19% identity, 66% coverage: 22:273/379 of query aligns to 12:275/391 of 8wbvA
Sites not aligning to the query:
8wbuA The crystal structure of circular mannose with mutant h247f of the cellobiose 2-epimerase from caldicellulosiruptor saccharolyticus
19% identity, 66% coverage: 22:273/379 of query aligns to 12:275/391 of 8wbuA
Sites not aligning to the query:
2zblA Functional annotation of salmonella enterica yihs-encoded protein (see paper)
26% identity, 42% coverage: 91:249/379 of query aligns to 79:239/416 of 2zblA
Sites not aligning to the query:
7ag4D Crystal structure of active site mutant of sq isomerase (yihs-h248a) from salmonella enterica in complex with sulfofructose (sf) (see paper)
26% identity, 42% coverage: 91:249/379 of query aligns to 91:251/425 of 7ag4D
Sites not aligning to the query:
P32140 Sulfoquinovose isomerase; SQ isomerase; Sulfoquinovose-sulfofructose isomerase; SQ-SF isomerase; EC 5.3.1.31 from Escherichia coli (strain K12) (see paper)
24% identity, 46% coverage: 91:263/379 of query aligns to 79:264/413 of P32140
Sites not aligning to the query:
>RR42_RS28130 FitnessBrowser__Cup4G11:RR42_RS28130
MNVTPPLATAGADPKAASFAALRAHYDGVVLPLWTGPGWNATMQLPYEALSGTDQQPLPV
ARYRAMACARQLYVFSQCDGTDGAAHAARLFASLGGRFADGGQGGFIYSIDAQGQPLDTT
KDLYTHAFVVFACAAYFKRSGSAQARALLDGATRLIEARFATADGLYHAALAQDFRPLGG
PPQQNPIMHLTEAYLAAFEVTGERFYADRLAGIAAAVLATFVDPATGCIAELPMCTDRAG
NRVEPGHQFEWFSLLASAPALFEDSGLAQALARAFGFAMQHGVDTSTMGVAAALHLDGSP
RDPIQRIWAQTEFARALAVRGDSVALAHLQAWLKAYPARFLHAGGWHECLSPAGKVERAE
MPSTTPYHLATAYQALPRD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory