Comparing RR42_RS28355 FitnessBrowser__Cup4G11:RR42_RS28355 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6e6iA Crystal structure of 4-methyl hopda bound to ligy from sphingobium sp. Strain syk-6
44% identity, 97% coverage: 1:325/334 of query aligns to 1:329/332 of 6e6iA
5vn5C Crystal structure of ligy from sphingobium sp. Strain syk-6 (see paper)
44% identity, 97% coverage: 1:325/334 of query aligns to 1:329/334 of 5vn5C
G2IQQ5 2-keto-4-carboxy-3-hexenedioate hydratase; KCH hydratase; EC 4.2.1.- from Sphingobium sp. (strain NBRC 103272 / SYK-6) (see paper)
38% identity, 98% coverage: 1:326/334 of query aligns to 3:331/341 of G2IQQ5
6dxsA Crystal structure of the ligj hydratase e284q mutant substrate complex with (3z)-2-keto-4-carboxy-3-hexenedioate (see paper)
38% identity, 98% coverage: 1:326/334 of query aligns to 2:330/342 of 6dxsA
6dxqA Crystal structure of the ligj hydratase product complex with 4- carboxy-4-hydroxy-2-oxoadipate (see paper)
38% identity, 97% coverage: 2:326/334 of query aligns to 1:328/338 of 6dxqA
2gwgA Crystal structure of 4-oxalomesaconate hydratase, ligj, from rhodopseudomonas palustris, northeast structural genomics target rpr66.
36% identity, 98% coverage: 1:326/334 of query aligns to 1:316/329 of 2gwgA
Q12BV1 Gamma-resorcylate decarboxylase; Gamma-RSD; 2,6-dihydroxybenzoate decarboxylase; 2,6-DHBD; EC 4.1.1.103 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
30% identity, 71% coverage: 43:280/334 of query aligns to 39:289/326 of Q12BV1
Sites not aligning to the query:
4qroA Crystal structure of dihydroxybenzoic acid decarbboxylase bpro_2061 (target efi-500288) from polaromonas sp. Js666 with bound manganese and an inhibitor, 2-nitroresorcinol
31% identity, 71% coverage: 43:280/334 of query aligns to 39:289/332 of 4qroA
Sites not aligning to the query:
4ih3A 2.5 angstroms x-ray crystal structure of of human 2-amino-3- carboxymuconate-6-semialdehyde decarboxylase in complex with dipicolinic acid (see paper)
30% identity, 84% coverage: 1:280/334 of query aligns to 1:293/332 of 4ih3A
Sites not aligning to the query:
2wm1A The crystal structure of human alpha-amino-beta-carboxymuconate- epsilon-semialdehyde decarboxylase in complex with 1,3- dihydroxyacetonephosphate suggests a regulatory link between NAD synthesis and glycolysis (see paper)
30% identity, 84% coverage: 1:280/334 of query aligns to 1:293/332 of 2wm1A
Sites not aligning to the query:
4ofcA 2.0 angstroms x-ray crystal structure of human 2-amino-3- carboxymuconate-6-semialdehye decarboxylase (see paper)
30% identity, 84% coverage: 1:280/334 of query aligns to 1:293/335 of 4ofcA
Q8TDX5 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; Picolinate carboxylase; EC 4.1.1.45 from Homo sapiens (Human) (see paper)
30% identity, 84% coverage: 1:280/334 of query aligns to 1:293/336 of Q8TDX5
7pwyA Structure of human dimeric acmsd in complex with the inhibitor tes- 1025 (see paper)
30% identity, 83% coverage: 3:280/334 of query aligns to 2:292/334 of 7pwyA
Sites not aligning to the query:
7pwyC Structure of human dimeric acmsd in complex with the inhibitor tes- 1025 (see paper)
33% identity, 70% coverage: 48:280/334 of query aligns to 50:263/301 of 7pwyC
Sites not aligning to the query:
2dvxA Crystal structure of 2,6-dihydroxybenzoate decarboxylase complexed with inhibitor 2,3-dihydroxybenzaldehyde
30% identity, 60% coverage: 82:280/334 of query aligns to 77:289/325 of 2dvxA
Sites not aligning to the query:
2dvuA Crystal structure of 2,6-dihydroxybenzoate decarboxylase complexed with 2,6-dihydroxybenzoate
30% identity, 60% coverage: 82:280/334 of query aligns to 77:289/325 of 2dvuA
Sites not aligning to the query:
2dvtA Crystal structure of 2,6-dihydroxybenzoate decarboxylase from rhizobium
30% identity, 60% coverage: 82:280/334 of query aligns to 77:289/325 of 2dvtA
Sites not aligning to the query:
Q60FX6 Gamma-resorcylate decarboxylase; 2,6-dihydroxybenzoate decarboxylase; Reversible gamma-RA decarboxylase; EC 4.1.1.103 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
30% identity, 60% coverage: 82:280/334 of query aligns to 77:289/327 of Q60FX6
Q60GU1 Gamma-resorcylate decarboxylase; GRDC; Gamma-RDC; 2,6-dihydroxybenzoate decarboxylase; EC 4.1.1.103 from Rhizobium sp. (strain MTP-10005) (see paper)
30% identity, 60% coverage: 82:280/334 of query aligns to 77:289/327 of Q60GU1
Sites not aligning to the query:
6jqxA Crystal structure of a hydrogenase from trichosporon moniliiforme (see paper)
27% identity, 74% coverage: 79:324/334 of query aligns to 80:342/352 of 6jqxA
Sites not aligning to the query:
>RR42_RS28355 FitnessBrowser__Cup4G11:RR42_RS28355
MIIDSHAHIVMPPESFRYMAELVGGRANPSTTPKVPDASVRKVAEELVQSMDKVGTDVQF
ISPRPYLQMHSVKPGRVTELWSRHCNDLIARFVALFPDRFRGVAGLPQYMNESPALRAVP
ELERCVKELGFVGCLINPDPTEGEGPTPPGLGDPFWYPLYDAMTQLDVPGLIHSAGSCSA
RESYTLKFINEESIAIVSLLGSKVFDTYPGLKIVVAHGGGAIPYQMGRFRSWSVRKGETV
SFDEQLKRLYFDTCNYSKEAIELLLKVAGTDNVLFGTEKPGTGSARDPVSGRDYDDMKPV
IESIDWLSEQQRRNIFECNCTRVYSRAFRKDEAC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory