Comparing RR42_RS28450 FitnessBrowser__Cup4G11:RR42_RS28450 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
P00926 D-serine dehydratase; D-serine deaminase; DSD; EC 4.3.1.18 from Escherichia coli (strain K12) (see paper)
47% identity, 94% coverage: 21:451/457 of query aligns to 15:440/442 of P00926
3ss7X Crystal structure of holo d-serine dehydratase from escherichia coli at 1.55 a resolution (see paper)
47% identity, 94% coverage: 21:451/457 of query aligns to 10:435/437 of 3ss7X
3r0xA Crystal structure of selenomethionine incorporated apo d-serine deaminase from salmonella tyhimurium (see paper)
47% identity, 94% coverage: 21:451/457 of query aligns to 13:438/438 of 3r0xA
5ygrD Crystal structure of plp bound diaminopropionate ammonia lyase from salmonella typhimurium (see paper)
24% identity, 56% coverage: 156:411/457 of query aligns to 92:336/388 of 5ygrD
Sites not aligning to the query:
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
26% identity, 52% coverage: 163:401/457 of query aligns to 60:283/310 of 7nbgDDD
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
26% identity, 52% coverage: 163:401/457 of query aligns to 61:284/322 of 3l6bA
Sites not aligning to the query:
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
25% identity, 50% coverage: 173:401/457 of query aligns to 76:288/320 of 7nbhAAA
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
25% identity, 50% coverage: 173:401/457 of query aligns to 76:288/322 of 7nbgAAA
Sites not aligning to the query:
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
25% identity, 50% coverage: 173:401/457 of query aligns to 76:288/323 of 7nbfAAA
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
25% identity, 50% coverage: 173:401/457 of query aligns to 76:288/323 of 7nbdAAA
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
25% identity, 50% coverage: 173:401/457 of query aligns to 76:288/323 of 7nbcCCC
Sites not aligning to the query:
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
25% identity, 50% coverage: 173:401/457 of query aligns to 76:288/323 of 7nbcAAA
Sites not aligning to the query:
6zspAAA serine racemase bound to atp and malonate. (see paper)
25% identity, 50% coverage: 173:401/457 of query aligns to 69:281/320 of 6zspAAA
Sites not aligning to the query:
5ygrB Crystal structure of plp bound diaminopropionate ammonia lyase from salmonella typhimurium (see paper)
25% identity, 42% coverage: 177:368/457 of query aligns to 102:309/365 of 5ygrB
Sites not aligning to the query:
P66899 Diaminopropionate ammonia-lyase; DAPAL; 2,3-diaminopropionate ammonia-lyase; Alpha,beta-diaminopropionate ammonia-lyase; Diaminopropionatase; EC 4.3.1.15 from Escherichia coli (strain K12) (see paper)
21% identity, 47% coverage: 161:374/457 of query aligns to 103:314/398 of P66899
Sites not aligning to the query:
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
26% identity, 51% coverage: 173:404/457 of query aligns to 82:297/514 of P04968
Sites not aligning to the query:
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
25% identity, 54% coverage: 173:421/457 of query aligns to 78:301/494 of 1tdjA
Sites not aligning to the query:
>RR42_RS28450 FitnessBrowser__Cup4G11:RR42_RS28450
MNQPLAMNPSTAAGPHAAAALRASLAAATPLLWCNPARAVTPPPVQAAGEHSISLADVEA
AQARFARFAPLLSALFPELAGTHGVIESPLVAVPSMQTALGLPHSQGRLWVKADHSLPVA
GSIKARGGIHEVLEFAENLALRHGLVGPGRNEPEHYLALREPAARALFGRYQVAVGSTGN
LGLSIGVMASALGFRAAVHMSSDAKAWKKARLRNRGVEVVEHAGDYEDAVAAGRRQAQQD
EFTYFVDDERSLSLLLGYSAAALHLRQQLAAHAIRVDAEHPLFVYLPCGVGGAPAGITFG
MRQLFGPHVHCVFAEPVQSPCFLVQMMAGAGNPSVYDFGLSNSTQADGLAVPRASELAAG
VMRPLLSGVFTVADDTLFEHLALAWRTQGLRIEPSAAAGFSGPRMLCESPAGRDYLARHQ
LEAMMPQATHLVWTTGGLFVPPAEYQGFLDKAAALAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory