SitesBLAST
Comparing RR42_RS28545 FitnessBrowser__Cup4G11:RR42_RS28545 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9LKJ1 3-hydroxyisobutyryl-CoA hydrolase 1; CoA-thioester hydrolase CHY1; EC 3.1.2.-; EC 3.1.2.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 92% coverage: 14:365/384 of query aligns to 2:354/378 of Q9LKJ1
- G70 (= G83) mutation to S: Loss of activity.
- E142 (= E154) mutation to A: Loss of activity.
- D150 (= D162) mutation to G: Reduced activity.
4hdtA Crystal structure of a carnitinyl-coa dehydratase from mycobacterium thermoresistibile (see paper)
38% identity, 90% coverage: 20:364/384 of query aligns to 1:328/340 of 4hdtA
- active site: G64 (= G83), I69 (≠ L88), W84 (≠ F103), Y88 (= Y107), G112 (= G131), G115 (= G134), E135 (= E154), P142 (= P161), D143 (= D162), R283 (= R315)
- binding zinc ion: H28 (≠ Y47), E42 (≠ A61), E57 (≠ P76), E79 (≠ L98), H93 (≠ R112), H185 (≠ A204)
Sites not aligning to the query:
3bptA Crystal structure of human beta-hydroxyisobutyryl-coa hydrolase in complex with quercetin
33% identity, 91% coverage: 19:366/384 of query aligns to 3:347/362 of 3bptA
- active site: G67 (= G83), P84 (≠ R100), R88 (≠ V104), G115 (= G131), G118 (= G134), E138 (= E154), D146 (= D162)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: G66 (= G82), G67 (= G83), I69 (= I85), E90 (= E106), G114 (= G130), G115 (= G131), E138 (= E154), D146 (= D162), V147 (= V163)
- binding 3,5,7,3',4'-pentahydroxyflavone: F25 (≠ Q41), L26 (= L42), A28 (= A44), G66 (= G82), G67 (= G83), I69 (= I85), P137 (= P153), I141 (= I157), L319 (≠ I338)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
31% identity, 47% coverage: 34:215/384 of query aligns to 17:195/259 of 5zaiC
- active site: A65 (≠ G83), F70 (≠ Y89), S82 (≠ F103), R86 (≠ Y107), G110 (= G131), E113 (≠ G134), P132 (= P153), E133 (= E154), I138 (≠ L159), P140 (= P161), G141 (≠ D162)
- binding coenzyme a: K24 (≠ Q41), L25 (= L42), A63 (= A81), G64 (= G82), A65 (≠ G83), D66 (= D84), I67 (= I85), P132 (= P153), R166 (≠ T186)
Sites not aligning to the query:
7xwvA Feruloyl-coa hydratase/lyase complexed with vanillin and coenzyme a (see paper)
29% identity, 49% coverage: 20:208/384 of query aligns to 4:193/244 of 7xwvA
- binding coenzyme a: T24 (≠ R40), K25 (≠ Q41), R26 (≠ L42), A64 (= A81), G65 (= G82), M66 (≠ G83), D67 (= D84), L68 (≠ I85), W111 (≠ I127), F113 (≠ M129), G114 (= G130), G115 (= G131), S137 (≠ P153)
- binding 4-hydroxy-3-methoxybenzaldehyde: M66 (≠ G83), Y71 (≠ L88), F72 (≠ Y89), E138 (= E154), G146 (≠ D162), G147 (≠ V163)
7xwtB Crystal structure of feruoyl-coa hydratase/lyase complexed with coa from sphingomonas paucimobilis (see paper)
29% identity, 49% coverage: 20:208/384 of query aligns to 5:194/277 of 7xwtB
- binding acetyl coenzyme *a: T25 (≠ R40), K26 (≠ Q41), R27 (≠ L42), A29 (= A44), A65 (= A81), G66 (= G82), M67 (≠ G83), D68 (= D84), L69 (≠ I85), F73 (≠ Y89), F114 (≠ M129), G116 (= G131), S138 (≠ P153), W142 (≠ I157)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
33% identity, 47% coverage: 29:207/384 of query aligns to 15:188/260 of 2hw5C
- active site: A68 (≠ G83), M73 (≠ L88), S83 (≠ R100), L87 (≠ V104), G111 (= G131), E114 (≠ G134), P133 (= P153), E134 (= E154), T139 (≠ L159), P141 (= P161), G142 (≠ D162)
- binding crotonyl coenzyme a: K26 (≠ R40), A27 (≠ Q41), L28 (= L42), A30 (= A44), K62 (= K77), I70 (= I85), F109 (≠ M129)
Sites not aligning to the query:
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
31% identity, 46% coverage: 31:207/384 of query aligns to 16:182/254 of 2dubA
- active site: A67 (≠ G83), M72 (≠ L88), S82 (≠ Q108), G105 (= G131), E108 (≠ G134), P127 (= P153), E128 (= E154), T133 (≠ L159), P135 (= P161), G136 (≠ D162)
- binding octanoyl-coenzyme a: K25 (≠ R40), A26 (≠ Q41), L27 (= L42), A29 (= A44), A65 (= A81), A67 (≠ G83), D68 (= D84), I69 (= I85), K70 (≠ R86), G105 (= G131), E108 (≠ G134), P127 (= P153), E128 (= E154), G136 (≠ D162), A137 (≠ V163)
Sites not aligning to the query:
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
31% identity, 46% coverage: 31:207/384 of query aligns to 17:188/260 of 1dubA
- active site: A68 (≠ G83), M73 (≠ L88), S83 (≠ Q108), L87 (≠ R112), G111 (= G131), E114 (≠ G134), P133 (= P153), E134 (= E154), T139 (≠ L159), P141 (= P161), G142 (≠ D162)
- binding acetoacetyl-coenzyme a: K26 (≠ R40), A27 (≠ Q41), L28 (= L42), A30 (= A44), A66 (= A81), A68 (≠ G83), D69 (= D84), I70 (= I85), Y107 (≠ I127), G110 (= G130), G111 (= G131), E114 (≠ G134), P133 (= P153), E134 (= E154), L137 (≠ I157), G142 (≠ D162)
Sites not aligning to the query:
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
31% identity, 46% coverage: 31:207/384 of query aligns to 47:218/290 of P14604
- E144 (≠ G134) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (= E154) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
31% identity, 46% coverage: 31:207/384 of query aligns to 15:186/258 of 1ey3A
- active site: A66 (≠ G83), M71 (≠ L88), S81 (≠ Q108), L85 (≠ R112), G109 (= G131), E112 (≠ G134), P131 (= P153), E132 (= E154), T137 (≠ L159), P139 (= P161), G140 (≠ D162)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ R40), L26 (= L42), A28 (= A44), A64 (= A81), G65 (= G82), A66 (≠ G83), D67 (= D84), I68 (= I85), L85 (≠ R112), W88 (≠ C115), G109 (= G131), P131 (= P153), L135 (≠ I157), G140 (≠ D162)
Sites not aligning to the query:
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
32% identity, 46% coverage: 31:207/384 of query aligns to 17:186/258 of 1mj3A
- active site: A68 (≠ G83), M73 (≠ L88), S83 (≠ Q108), L85 (= L109), G109 (= G131), E112 (≠ G134), P131 (= P153), E132 (= E154), T137 (≠ L159), P139 (= P161), G140 (≠ D162)
- binding hexanoyl-coenzyme a: K26 (≠ R40), A27 (≠ Q41), L28 (= L42), A30 (= A44), A66 (= A81), G67 (= G82), A68 (≠ G83), D69 (= D84), I70 (= I85), G109 (= G131), P131 (= P153), E132 (= E154), L135 (≠ I157), G140 (≠ D162)
Sites not aligning to the query:
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
30% identity, 46% coverage: 31:207/384 of query aligns to 13:184/256 of 3h81A
- active site: A64 (≠ G83), M69 (≠ L88), T79 (≠ Q108), F83 (vs. gap), G107 (= G131), E110 (≠ G134), P129 (= P153), E130 (= E154), V135 (≠ L159), P137 (= P161), G138 (≠ D162)
Sites not aligning to the query:
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
30% identity, 46% coverage: 31:207/384 of query aligns to 14:185/255 of 3q0jC
- active site: A65 (≠ G83), M70 (≠ L88), T80 (≠ Q108), F84 (vs. gap), G108 (= G131), E111 (≠ G134), P130 (= P153), E131 (= E154), V136 (≠ L159), P138 (= P161), G139 (≠ D162)
- binding acetoacetyl-coenzyme a: Q23 (≠ R40), A24 (≠ Q41), L25 (= L42), A27 (= A44), A63 (= A81), G64 (= G82), A65 (≠ G83), D66 (= D84), I67 (= I85), K68 (≠ R86), M70 (≠ L88), F84 (vs. gap), G107 (= G130), G108 (= G131), E111 (≠ G134), P130 (= P153), E131 (= E154), P138 (= P161), G139 (≠ D162), M140 (≠ V163)
Sites not aligning to the query:
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
30% identity, 46% coverage: 31:207/384 of query aligns to 14:185/255 of 3q0gC
- active site: A65 (≠ G83), M70 (≠ L88), T80 (≠ Q108), F84 (vs. gap), G108 (= G131), E111 (≠ G134), P130 (= P153), E131 (= E154), V136 (≠ L159), P138 (= P161), G139 (≠ D162)
- binding coenzyme a: L25 (= L42), A63 (= A81), I67 (= I85), K68 (≠ R86), Y104 (≠ I127), P130 (= P153), E131 (= E154), L134 (≠ I157)
Sites not aligning to the query:
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
31% identity, 46% coverage: 31:207/384 of query aligns to 13:180/250 of 3q0gD
- active site: A64 (≠ G83), M69 (≠ L88), T75 (≠ H93), F79 (≠ Y107), G103 (= G131), E106 (≠ G134), P125 (= P153), E126 (= E154), V131 (≠ L159), P133 (= P161), G134 (≠ D162)
Sites not aligning to the query:
4izcB Crystal structure of dmdd e121a in complex with mta-coa (see paper)
36% identity, 38% coverage: 29:172/384 of query aligns to 18:158/266 of 4izcB
- active site: L70 (≠ G83), H75 (vs. gap), C89 (≠ G95), H93 (= H99), G117 (= G131), A120 (≠ G134), E140 (= E154), G148 (≠ D162)
- binding methylthioacryloyl-CoA: D29 (≠ R40), K30 (≠ Q41), R31 (≠ L42), A33 (= A44), A68 (= A81), L70 (≠ G83), D71 (= D84), L72 (≠ I85), W92 (≠ L98), G117 (= G131), P139 (= P153), E140 (= E154), R143 (≠ I157), G148 (≠ D162)
Sites not aligning to the query:
4izdA Crystal structure of dmdd e121a in complex with mmpa-coa (see paper)
36% identity, 38% coverage: 29:172/384 of query aligns to 18:158/253 of 4izdA
- active site: L70 (≠ G83), H75 (vs. gap), C89 (≠ G95), H93 (= H99), G117 (= G131), A120 (≠ G134), E140 (= E154), G148 (≠ D162)
- binding 3-methylmercaptopropionate-CoA (MMPA-CoA): D29 (≠ R40), K30 (≠ Q41), R31 (≠ L42), A33 (= A44), A68 (= A81), L70 (≠ G83), D71 (= D84), L72 (≠ I85)
Sites not aligning to the query:
Q5LLW6 Methylthioacryloyl-CoA hydratase; EC 4.2.1.155 from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) (see paper)
36% identity, 38% coverage: 29:172/384 of query aligns to 19:159/267 of Q5LLW6
- K31 (≠ Q41) binding
- R32 (≠ L42) binding
- A69 (= A81) binding
- L71 (≠ G83) binding
- L73 (≠ I85) binding
- G118 (= G131) binding
- E121 (≠ G134) active site, Nucleophile; mutation to A: Abolishes catalytic activity.
- E141 (= E154) active site, Proton acceptor; mutation to A: Abolishes catalytic activity.
- R144 (≠ I157) binding
- G149 (≠ D162) binding
6eqoA Tri-functional propionyl-coa synthase of erythrobacter sp. Nap1 with bound NADP+ and phosphomethylphosphonic acid adenylate ester (see paper)
33% identity, 40% coverage: 31:185/384 of query aligns to 867:1016/1804 of 6eqoA
Sites not aligning to the query:
- binding phosphomethylphosphonic acid adenylate ester: 456, 458, 535, 536, 537, 538, 558, 559, 560, 561, 562, 688, 714
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 1261, 1265, 1379, 1400, 1403, 1404, 1405, 1424, 1425, 1429, 1444, 1492, 1493, 1497, 1514, 1517, 1713, 1730, 1731, 1774
Query Sequence
>RR42_RS28545 FitnessBrowser__Cup4G11:RR42_RS28545
MRLNPNDAAQERPAAAPSADDEVRFDEINGIGLITLNRPRQLNALSYPMIGLLDAQLAAW
AARDDIAAVVLRGAGPKAFCAGGDIRALYDSFHAGTALHRQFFVDEYQLDYRLHCYPKPV
VALMDGIVMGGGMGLAQAAHLRVLTERSRVAMPETGIGLVPDVGASHFLSKLPLALALYV
GLTGVTLGAADTLLCKLADIAVPAASLEHFEQTLAAINRTGDVLADLRAALQATPDAGEQ
AAPLQSVLPAVLRHFRADASVAGLLDSLAAESDPAYADWAARTLDILRGRSPLMMAVTRE
LLLRGRDLDLADCFRMELGVVSHAFSQGDFIEGVRALIVDKDNAPRWRVKDASEVSEAVV
QSFFDSPWPREPHPLAMLGRSGQA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory