SitesBLAST
Comparing RR42_RS28620 FitnessBrowser__Cup4G11:RR42_RS28620 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
47% identity, 70% coverage: 48:240/276 of query aligns to 32:226/378 of P69874
- F45 (= F61) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C70) mutation to T: Loss of ATPase activity and transport.
- L60 (= L76) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ V92) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V147) mutation to M: Loss of ATPase activity and transport.
- D172 (= D184) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 26 C→A: Lower ATPase activity and transport efficiency.
- 27 F→L: Lower ATPase activity and transport efficiency.
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
40% identity, 67% coverage: 52:235/276 of query aligns to 25:218/375 of 2d62A
1g291 Malk (see paper)
41% identity, 66% coverage: 52:234/276 of query aligns to 22:214/372 of 1g291
- binding magnesium ion: D69 (vs. gap), E71 (vs. gap), K72 (≠ D93), K79 (≠ P100), D80 (= D101)
- binding pyrophosphate 2-: S38 (= S68), G39 (= G69), C40 (= C70), G41 (= G71), K42 (= K72), T43 (≠ S73), T44 (= T74)
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
38% identity, 64% coverage: 59:235/276 of query aligns to 52:238/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12, 39, 40, 41
7aheC Opua inhibited inward facing (see paper)
38% identity, 64% coverage: 59:235/276 of query aligns to 52:238/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
36% identity, 66% coverage: 53:235/276 of query aligns to 46:238/260 of 7ahdC
- binding adenosine-5'-triphosphate: S61 (= S68), G62 (= G69), G64 (= G71), K65 (= K72), S66 (= S73), T67 (= T74), Q111 (= Q109), K161 (≠ R158), Q162 (= Q159), S164 (= S161), G166 (= G163), M167 (= M164), Q188 (≠ E185), H221 (= H218)
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
40% identity, 66% coverage: 52:233/276 of query aligns to 22:207/369 of P19566
- L86 (= L113) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P186) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D191) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
40% identity, 66% coverage: 52:233/276 of query aligns to 23:208/393 of P9WQI3
- H193 (= H218) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
39% identity, 66% coverage: 52:233/276 of query aligns to 21:206/374 of 2awnB
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
39% identity, 66% coverage: 52:233/276 of query aligns to 21:206/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S68), G38 (= G69), C39 (= C70), G40 (= G71), K41 (= K72), S42 (= S73), T43 (= T74), Q81 (= Q109), R128 (≠ A155), A132 (≠ Q159), S134 (= S161), G136 (= G163), Q137 (≠ M164), E158 (= E185), H191 (= H218)
- binding magnesium ion: S42 (= S73), Q81 (= Q109)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
39% identity, 66% coverage: 52:233/276 of query aligns to 21:206/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G69), C39 (= C70), G40 (= G71), K41 (= K72), S42 (= S73), T43 (= T74), R128 (≠ A155), S134 (= S161), Q137 (≠ M164)
- binding beryllium trifluoride ion: S37 (= S68), G38 (= G69), K41 (= K72), Q81 (= Q109), S134 (= S161), G136 (= G163), H191 (= H218)
- binding magnesium ion: S42 (= S73), Q81 (= Q109)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
39% identity, 66% coverage: 52:233/276 of query aligns to 21:206/371 of 3puwA
- binding adenosine-5'-diphosphate: G38 (= G69), C39 (= C70), G40 (= G71), K41 (= K72), S42 (= S73), T43 (= T74), R128 (≠ A155), A132 (≠ Q159), S134 (= S161), Q137 (≠ M164)
- binding tetrafluoroaluminate ion: S37 (= S68), G38 (= G69), K41 (= K72), Q81 (= Q109), S134 (= S161), G135 (= G162), G136 (= G163), E158 (= E185), H191 (= H218)
- binding magnesium ion: S42 (= S73), Q81 (= Q109)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
39% identity, 66% coverage: 52:233/276 of query aligns to 21:206/371 of 3puvA
- binding adenosine-5'-diphosphate: G38 (= G69), C39 (= C70), G40 (= G71), K41 (= K72), S42 (= S73), T43 (= T74), R128 (≠ A155), A132 (≠ Q159), S134 (= S161), Q137 (≠ M164)
- binding magnesium ion: S42 (= S73), Q81 (= Q109)
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
39% identity, 66% coverage: 52:233/276 of query aligns to 22:207/371 of P68187
- A85 (≠ T112) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ Q136) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ L144) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (= V147) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (vs. gap) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ T150) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G163) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D184) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
39% identity, 66% coverage: 52:233/276 of query aligns to 19:204/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S68), G36 (= G69), C37 (= C70), G38 (= G71), K39 (= K72), S40 (= S73), T41 (= T74), R126 (≠ A155), A130 (≠ Q159), S132 (= S161), G134 (= G163), Q135 (≠ M164)
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
39% identity, 67% coverage: 49:234/276 of query aligns to 22:203/353 of 1vciA
Sites not aligning to the query:
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
38% identity, 72% coverage: 38:235/276 of query aligns to 8:213/350 of 3fvqB
- binding adenosine-5'-triphosphate: F13 (≠ D43), Q14 (= Q44), T16 (≠ L46), V18 (= V48), S38 (= S68), G39 (= G69), C40 (= C70), G41 (= G71), K42 (= K72), T43 (≠ S73), T44 (= T74), R133 (≠ A155), E137 (≠ Q159), S139 (= S161), G141 (= G163), Q142 (≠ M164)
- binding calcium ion: T43 (≠ S73), Q86 (= Q109)
8hprD Lpqy-sugabc in state 4 (see paper)
37% identity, 74% coverage: 30:233/276 of query aligns to 3:207/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (≠ F39), S38 (= S68), C40 (= C70), G41 (= G71), K42 (= K72), S43 (= S73), T44 (= T74), Q82 (= Q109), R129 (≠ A155), Q133 (= Q159), S135 (= S161), G136 (= G162), G137 (= G163), Q159 (≠ E185), H192 (= H218)
- binding magnesium ion: S43 (= S73), Q82 (= Q109)
8hprC Lpqy-sugabc in state 4 (see paper)
37% identity, 74% coverage: 30:233/276 of query aligns to 3:207/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (≠ F39), S38 (= S68), G39 (= G69), G41 (= G71), K42 (= K72), S43 (= S73), Q82 (= Q109), Q133 (= Q159), G136 (= G162), G137 (= G163), Q138 (≠ M164), H192 (= H218)
- binding magnesium ion: S43 (= S73), Q82 (= Q109)
8hplC Lpqy-sugabc in state 1 (see paper)
39% identity, 67% coverage: 49:233/276 of query aligns to 17:205/384 of 8hplC
Sites not aligning to the query:
Query Sequence
>RR42_RS28620 FitnessBrowser__Cup4G11:RR42_RS28620
MVSAVLDKPAQAQPAQAATGRDSASNGVRLTIDQVSHHFTLRDQVLPVLSRVSLTAEPGE
FVALLGPSGCGKSTLLRLVAGLEPPRRGTLAVDGVPIGGPDPSRVVVFQDPTLYPWRTVW
DNAALGLEARGLLGSQRERVDDALARVGLTEFARAYPRQLSGGMAQRAALARALVNEPRL
LILDEPLGKLDSLTRLSMQGELVSLWQRARFTALLVTHDVEEALLLATRVIVFSERPARI
TAEIKIDRDYPRHRDDPELIRLRREILGLLGLGQGW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory