Comparing RR42_RS28855 FitnessBrowser__Cup4G11:RR42_RS28855 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
4v15A Crystal structure of d-threonine aldolase from alcaligenes xylosoxidans (see paper)
25% identity, 79% coverage: 45:379/422 of query aligns to 21:325/373 of 4v15A
Sites not aligning to the query:
7yqaB Crystal structure of d-threonine aldolase from chlamydomonas reinhardtii (see paper)
28% identity, 44% coverage: 40:225/422 of query aligns to 19:204/398 of 7yqaB
Sites not aligning to the query:
4pb3B D-threo-3-hydroxyaspartate dehydratase h351a mutant (see paper)
30% identity, 41% coverage: 42:214/422 of query aligns to 17:187/389 of 4pb3B
Sites not aligning to the query:
3wqeA D-threo-3-hydroxyaspartate dehydratase from delftia sp. Ht23 complexed with d-allothreonine (see paper)
30% identity, 41% coverage: 42:214/422 of query aligns to 7:177/379 of 3wqeA
Sites not aligning to the query:
3wqdA D-threo-3-hydroxyaspartate dehydratase from delftia sp. Ht23 complexed with d-erythro-3-hydroxyaspartate (see paper)
30% identity, 41% coverage: 42:214/422 of query aligns to 7:177/379 of 3wqdA
Sites not aligning to the query:
3wqcA D-threo-3-hydroxyaspartate dehydratase from delftia sp. Ht23 (see paper)
30% identity, 41% coverage: 42:214/422 of query aligns to 7:177/379 of 3wqcA
Sites not aligning to the query:
4pb5A D-threo-3-hydroxyaspartate dehydratase h351a mutant complexed with l- erythro-3-hydroxyaspartate (see paper)
30% identity, 41% coverage: 42:214/422 of query aligns to 7:177/379 of 4pb5A
Sites not aligning to the query:
4pb4A D-threo-3-hydroxyaspartate dehydratase h351a mutant complexed with 2- amino maleic acid (see paper)
30% identity, 41% coverage: 42:214/422 of query aligns to 7:177/379 of 4pb4A
Sites not aligning to the query:
B2DFG5 D-threo-3-hydroxyaspartate dehydratase; D-THA DH; D-THA dehydratase; Threo-3-hydroxy-D-aspartate ammonia-lyase; EC 4.3.1.27 from Delftia sp. (strain HT23) (see paper)
30% identity, 41% coverage: 42:214/422 of query aligns to 8:178/380 of B2DFG5
>RR42_RS28855 FitnessBrowser__Cup4G11:RR42_RS28855
MLEIKYQAGTIDPLNKALGKLDAPLAPDAAGQVGWQLLAEDLSLPAAVLYEERLAHNLEW
MRRFMGEYGVQLAPHGKTTMAPKLFARQLAAGAWGITLATAHQTAAAYAHGVRRVLMANQ
LVGRRNMEIVADLLRDPDFEFFTLVDSAALVDQLGRYFSARGQKLQVLLELGVPGGRTGV
RGAQQQAAVLAALARWPGVLSLAGVEIYEGVLQEEADIRDFLRRTVAVTRELFAAGRFGR
SPVVMSGAGSAWYDVVAEEFARTDIGAPIDIVLRPGCYLTHDVGIYRAAQKRILASNPVA
QKMREGLLPALQLWAYVQSIPEPERAIIGMGKRDAAFDAGMPIPAQVYRPGASVPVAVPA
HWEVTGMMDQHAYLAIRPGDDVQVGDMVAFDISHPCLTFDKWRHIPVLDGDLRVIDLVQT
FF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory