Comparing RR42_RS28860 FitnessBrowser__Cup4G11:RR42_RS28860 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
33% identity, 96% coverage: 5:303/311 of query aligns to 3:308/308 of 2dcnA
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
30% identity, 95% coverage: 3:297/311 of query aligns to 2:302/313 of Q97U29
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
30% identity, 95% coverage: 3:297/311 of query aligns to 1:301/311 of 2varA
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
32% identity, 92% coverage: 9:295/311 of query aligns to 8:297/306 of 5eynA
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
32% identity, 92% coverage: 9:295/311 of query aligns to 12:301/310 of 5yggA
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
31% identity, 90% coverage: 3:281/311 of query aligns to 2:279/309 of Q53W83
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
31% identity, 90% coverage: 3:281/311 of query aligns to 2:279/301 of 1v1aA
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
31% identity, 90% coverage: 3:281/311 of query aligns to 2:279/300 of 1v1bA
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 98% coverage: 5:309/311 of query aligns to 7:318/319 of Q8ZKR2
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
29% identity, 96% coverage: 5:302/311 of query aligns to 4:307/308 of 3iq0B
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
30% identity, 93% coverage: 5:294/311 of query aligns to 3:287/299 of 1tz3A
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
30% identity, 93% coverage: 5:294/311 of query aligns to 3:287/297 of 1tz6A
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
28% identity, 92% coverage: 5:289/311 of query aligns to 2:283/302 of 3gbuA
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
28% identity, 92% coverage: 5:289/311 of query aligns to 3:284/304 of 3ih0A
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
25% identity, 96% coverage: 2:299/311 of query aligns to 1:304/312 of 3in1A
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
30% identity, 89% coverage: 30:305/311 of query aligns to 38:304/306 of 4xckA
Sites not aligning to the query:
4ebuA Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
32% identity, 85% coverage: 3:267/311 of query aligns to 15:280/306 of 4ebuA
Sites not aligning to the query:
4eumA Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
31% identity, 85% coverage: 3:266/311 of query aligns to 15:275/294 of 4eumA
Sites not aligning to the query:
1gqtB Activation of ribokinase by monovalent cations (see paper)
27% identity, 77% coverage: 23:263/311 of query aligns to 33:264/307 of 1gqtB
Sites not aligning to the query:
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
27% identity, 77% coverage: 23:263/311 of query aligns to 34:265/309 of P0A9J6
Sites not aligning to the query:
>RR42_RS28860 FitnessBrowser__Cup4G11:RR42_RS28860
MSIDILAFGEALVEFNQQPDDPSRYLQGFGGDTSNFCIAAARQGARAGYISAVGEDTFGE
RLLALWTQERVDTRHVRIDAGAPTGVYFVTHDAHGHRFDYLRSGSAASHYSHENLPHHAI
AEARYLHVSGISLAISTSACDAGLAAMEHARKAGCQVTLDTNLRLRLWTLARARGIMREA
FALTDVCLPSWDDITVLTGLDDRDAIVDYLLGCGIGLVALKLGEEGAYVATPEARTLVPP
YTVRPVDATGAGDCFGGSFVARLAAGDDPFDAARYANVAAALSTTGYGAVAPIPSIETVL
ARMAQSVSVIA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory