Comparing RR42_RS28865 FitnessBrowser__Cup4G11:RR42_RS28865 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
1euaA Schiff base intermediate in kdpg aldolase from escherichia coli (see paper)
54% identity, 85% coverage: 26:207/214 of query aligns to 26:207/213 of 1euaA
P0A955 KHG/KDPG aldolase; EC 4.1.3.16; EC 4.1.2.14 from Escherichia coli (strain K12) (see 3 papers)
54% identity, 85% coverage: 26:207/214 of query aligns to 26:207/213 of P0A955
6oviA Crystal structure of kdpg aldolase from legionella pneumophila with pyruvate captured at low ph as a covalent carbinolamine intermediate
46% identity, 93% coverage: 16:213/214 of query aligns to 13:210/210 of 6oviA
2c0aB Mechanism of the class i kdpg aldolase (see paper)
53% identity, 85% coverage: 26:207/214 of query aligns to 27:208/214 of 2c0aB
Sites not aligning to the query:
1wauA Structure of kdpg aldolase e45n mutant (see paper)
53% identity, 85% coverage: 26:207/214 of query aligns to 26:207/213 of 1wauA
5xsfA Crystal structure of the 2-keto-3-deoxy-6-phosphogluconate aldolase of zymomonas mobilis zm4 with 3-phosphoglycerate
51% identity, 93% coverage: 16:214/214 of query aligns to 13:207/209 of 5xsfA
3vcrA Crystal structure of a putative kdpg (2-keto-3-deoxy-6- phosphogluconate) aldolase from oleispira antarctica (see paper)
50% identity, 91% coverage: 16:210/214 of query aligns to 13:213/216 of 3vcrA
1mxsA Crystal structure of 2-keto-3-deoxy-6-phosphogluconate (kdpg) aldolase from pseudomonas putida. (see paper)
44% identity, 91% coverage: 17:210/214 of query aligns to 19:212/216 of 1mxsA
P00885 2-dehydro-3-deoxy-phosphogluconate aldolase; KDPG-aldolase; Phospho-2-dehydro-3-deoxygluconate aldolase; Phospho-2-keto-3-deoxygluconate aldolase; EC 4.1.2.14 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
44% identity, 91% coverage: 17:210/214 of query aligns to 29:222/226 of P00885
Sites not aligning to the query:
1wa3D Mechanism of the class i kdpg aldolase (see paper)
36% identity, 70% coverage: 17:166/214 of query aligns to 11:160/203 of 1wa3D
Sites not aligning to the query:
2v82A Kdpgal complexed to kdpgal (see paper)
38% identity, 60% coverage: 14:141/214 of query aligns to 5:133/205 of 2v82A
Sites not aligning to the query:
Q6BF16 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; 2-oxo-3-deoxygalactonate 6-phosphate aldolase; 6-phospho-2-dehydro-3-deoxygalactonate aldolase; 6-phospho-2-keto-3-deoxygalactonate aldolase; KDPGal; EC 4.1.2.21 from Escherichia coli (strain K12) (see paper)
38% identity, 60% coverage: 14:141/214 of query aligns to 6:134/205 of Q6BF16
Sites not aligning to the query:
>RR42_RS28865 FitnessBrowser__Cup4G11:RR42_RS28865
MQSQSPSLIERLVNVPVIPVLEFSSVDEALHVSEALIGGGLPVLEITLRTPVALDAIKAV
AAAFPQACVGAGTVLTAADLKAVSDAGAQFAVSPGLTPALAVAAQGAGVALLPGVATASE
AMAAMEAGFKFLKFFPAEASGGVPMLKSLYGPFAQLRFCPTGGIDLARAPTYLALPNVVC
VGGSWVVPKDAVAKGDWARVRTLAQEAAALRKSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory