SitesBLAST
Comparing RR42_RS29140 FitnessBrowser__Cup4G11:RR42_RS29140 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wo1A Hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit (see paper)
29% identity, 97% coverage: 14:554/558 of query aligns to 10:535/551 of 6wo1A
- active site: Y30 (≠ V34), G32 (= G36), G33 (≠ E37), A34 (≠ S38), I35 (≠ F39), E56 (= E60), T79 (= T83), F118 (= F122), Q119 (= Q123), E120 (= E124), K168 (≠ E172), M255 (vs. gap), V282 (≠ A290), V398 (≠ A398), G424 (= G423), M426 (= M425), D451 (= D450), N478 (= N477)
- binding 2-methylpyrimidin-4-amine: G424 (= G423), T425 (≠ A424), M426 (= M425)
- binding diphosphate: V398 (≠ A398), G399 (= G399), Q400 (≠ N400), H401 (≠ Y401), G450 (= G449), D451 (= D450), A452 (≠ G451), S453 (≠ C452)
- binding flavin-adenine dinucleotide: D97 (= D101), R158 (= R162), G208 (= G217), G210 (= G218), S213 (≠ W221), T235 (≠ A243), L236 (≠ F244), Q237 (≠ R245), I253 (≠ V258), G254 (= G259), M255 (vs. gap), G275 (= G283), V276 (≠ T284), R277 (= R285), D279 (≠ G287), R281 (≠ I289), V282 (≠ A290), E308 (≠ H310), I309 (≠ A311), D327 (≠ G329), V328 (≠ I330), Q402 (≠ T402), G421 (vs. gap), G422 (≠ T421)
- binding magnesium ion: D451 (= D450), N478 (= N477)
7egvA Acetolactate synthase from trichoderma harzianum with inhibitor harzianic acid (see paper)
29% identity, 96% coverage: 13:548/558 of query aligns to 7:551/590 of 7egvA
- active site: Y28 (≠ V34), G30 (= G36), G31 (≠ E37), A32 (≠ S38), I33 (≠ F39), E54 (= E60), T77 (= T83), F116 (= F122), Q117 (= Q123), K166 (≠ E172), E220 (≠ D228), M256 (≠ L263), V283 (≠ A290), V400 (≠ A398), L425 (≠ C422), G426 (= G423), M428 (= M425), Q483 (≠ Y480), M485 (≠ T482), V486 (≠ I483), W489 (≠ H486), L511 (≠ M508), G516 (= G513), I517 (≠ A514)
- binding flavin-adenine dinucleotide: R156 (= R162), G209 (= G217), Q210 (≠ G218), G211 (≠ A219), T236 (≠ A243), L237 (≠ F244), H238 (≠ R245), G276 (= G283), S277 (≠ T284), R278 (= R285), D280 (≠ G287), R282 (≠ I289), V283 (≠ A290), E309 (≠ H310), I310 (≠ A311), D328 (≠ G329), V329 (≠ I330), M405 (≠ V403), G423 (vs. gap), G424 (≠ T421)
- binding (2S)-3-methyl-2-[[(2S,4R)-1-methyl-4-[(2E,4E)-octa-2,4-dienoyl]-3,5-bis(oxidanylidene)pyrrolidin-2-yl]methyl]-2-oxidanyl-butanoic acid: F493 (≠ R490), Y494 (= Y491)
- binding magnesium ion: D453 (= D450), N480 (= N477), E482 (≠ M479)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: P29 (= P35), E54 (= E60), Q117 (= Q123), V400 (≠ A398), G401 (= G399), Q402 (≠ N400), H403 (≠ Y401), G426 (= G423), M428 (= M425), D453 (= D450), A454 (≠ G451), S455 (≠ C452), E482 (≠ M479), Q483 (≠ Y480), G484 (= G481), M485 (≠ T482), V486 (≠ I483)
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
27% identity, 96% coverage: 14:548/558 of query aligns to 9:552/591 of 5wkcA
- active site: Y29 (≠ V34), G31 (= G36), G32 (≠ E37), A33 (≠ S38), I34 (≠ F39), E55 (= E60), T78 (= T83), F117 (= F122), Q118 (= Q123), E119 (= E124), K167 (≠ E172), R222 (≠ A227), M258 (≠ L263), V285 (≠ A290), V401 (≠ A398), L426 (≠ C422), G427 (= G423), M429 (= M425), D454 (= D450), N481 (= N477), E483 (≠ M479), Q484 (≠ Y480), M486 (≠ T482), V487 (≠ I483), W490 (≠ H486), L512 (≠ M508), G517 (= G513), L518 (≠ A514), K551 (≠ P547)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (≠ A398), G402 (= G399), Q403 (≠ N400), H404 (≠ Y401), G427 (= G423), M429 (= M425), G453 (= G449), D454 (= D450), A455 (≠ G451), S456 (≠ C452), M459 (= M455), N481 (= N477), E483 (≠ M479), Q484 (≠ Y480), G485 (= G481), M486 (≠ T482), V487 (≠ I483)
- binding ethaneperoxoic acid: G32 (≠ E37), Q118 (= Q123)
- binding flavin-adenine dinucleotide: R157 (= R162), G211 (= G217), A212 (vs. gap), G213 (= G218), N216 (≠ W221), T238 (≠ A243), L239 (≠ F244), Q240 (≠ R245), L256 (= L261), M258 (≠ L263), G278 (= G283), A279 (≠ T284), R280 (= R285), R284 (≠ I289), V285 (≠ A290), E311 (≠ H310), V312 (≠ A311), N316 (≠ E315), D330 (≠ G329), A331 (≠ I330), M406 (≠ V403), G424 (vs. gap)
- binding magnesium ion: D454 (= D450), N481 (= N477), E483 (≠ M479)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (≠ E37), A33 (≠ S38), V107 (≠ I112), F117 (= F122), K167 (≠ E172), M258 (≠ L263), R284 (≠ I289), M486 (≠ T482), W490 (≠ H486)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (= P35), E55 (= E60)
1t9bA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
27% identity, 96% coverage: 14:548/558 of query aligns to 9:544/583 of 1t9bA
- active site: Y29 (≠ V34), G31 (= G36), G32 (≠ E37), A33 (≠ S38), I34 (≠ F39), E55 (= E60), T78 (= T83), F117 (= F122), Q118 (= Q123), E119 (= E124), K167 (≠ E172), R214 (≠ A227), M250 (≠ L263), V277 (≠ A290), V393 (≠ A398), L418 (≠ C422), G419 (= G423), M421 (= M425), D446 (= D450), N473 (= N477), E475 (≠ M479), Q476 (≠ Y480), M478 (≠ T482), V479 (≠ I483), W482 (≠ H486), L504 (≠ M508), G509 (= G513), L510 (≠ A514), K543 (≠ P547)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (≠ I112), P108 (≠ A113), F117 (= F122), D275 (= D288), R276 (≠ I289), M478 (≠ T482), W482 (≠ H486)
- binding flavin-adenine dinucleotide: R157 (= R162), G203 (= G217), A204 (vs. gap), G205 (= G218), N208 (≠ W221), T230 (≠ A243), L231 (≠ F244), Q232 (≠ R245), M247 (≠ H260), L248 (= L261), M250 (≠ L263), H251 (≠ G264), G270 (= G283), A271 (≠ T284), R272 (= R285), D274 (≠ G287), R276 (≠ I289), V277 (≠ A290), E303 (≠ H310), V304 (≠ A311), N308 (≠ E315), D322 (≠ G329), A323 (≠ I330), Q397 (≠ T402), M398 (≠ V403), G416 (vs. gap), G417 (≠ T421)
- binding magnesium ion: D446 (= D450), N473 (= N477), E475 (≠ M479)
1t9dB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
27% identity, 96% coverage: 14:548/558 of query aligns to 8:543/582 of 1t9dB
- active site: Y28 (≠ V34), G30 (= G36), G31 (≠ E37), A32 (≠ S38), I33 (≠ F39), E54 (= E60), T77 (= T83), F116 (= F122), Q117 (= Q123), E118 (= E124), K166 (≠ E172), R213 (≠ A227), M249 (≠ L263), V276 (≠ A290), V392 (≠ A398), L417 (≠ C422), G418 (= G423), M420 (= M425), D445 (= D450), N472 (= N477), E474 (≠ M479), Q475 (≠ Y480), M477 (≠ T482), V478 (≠ I483), W481 (≠ H486), L503 (≠ M508), G508 (= G513), L509 (≠ A514), K542 (≠ P547)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G31 (≠ E37), A32 (≠ S38), V106 (≠ I112), P107 (≠ A113), F116 (= F122), K166 (≠ E172), M249 (≠ L263), D274 (= D288), R275 (≠ I289), W481 (≠ H486)
- binding flavin-adenine dinucleotide: R156 (= R162), G202 (= G217), A203 (vs. gap), G204 (= G218), N207 (≠ W221), T229 (≠ A243), L230 (≠ F244), Q231 (≠ R245), L247 (= L261), M249 (≠ L263), H250 (≠ G264), G269 (= G283), A270 (≠ T284), R271 (= R285), D273 (≠ G287), R275 (≠ I289), V276 (≠ A290), E302 (≠ H310), V303 (≠ A311), N307 (≠ E315), G320 (≠ A328), D321 (≠ G329), A322 (≠ I330), Q396 (≠ T402), M397 (≠ V403), G415 (vs. gap), G416 (≠ T421)
- binding magnesium ion: D445 (= D450), N472 (= N477), E474 (≠ M479)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E54 (= E60), P80 (= P86), G418 (= G423), M420 (= M425), M450 (= M455)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
27% identity, 96% coverage: 14:548/558 of query aligns to 9:557/596 of 1t9cA
- active site: Y29 (≠ V34), G31 (= G36), G32 (≠ E37), A33 (≠ S38), I34 (≠ F39), E55 (= E60), T78 (= T83), F117 (= F122), Q118 (= Q123), E119 (= E124), K167 (≠ E172), R227 (≠ A227), M263 (≠ L263), V290 (≠ A290), V406 (≠ A398), L431 (≠ C422), G432 (= G423), M434 (= M425), D459 (= D450), N486 (= N477), E488 (≠ M479), Q489 (≠ Y480), M491 (≠ T482), V492 (≠ I483), W495 (≠ H486), L517 (≠ M508), G522 (= G513), L523 (≠ A514), K556 (≠ P547)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ E37), V107 (≠ I112), P108 (≠ A113), F117 (= F122), K167 (≠ E172), D288 (= D288), R289 (≠ I289), W495 (≠ H486)
- binding flavin-adenine dinucleotide: R157 (= R162), G216 (= G217), A217 (vs. gap), G218 (= G218), N221 (≠ W221), T243 (≠ A243), L244 (≠ F244), Q245 (≠ R245), L261 (= L261), M263 (≠ L263), H264 (≠ G264), G283 (= G283), A284 (≠ T284), R285 (= R285), D287 (≠ G287), R289 (≠ I289), V290 (≠ A290), E316 (≠ H310), V317 (≠ A311), N321 (≠ E315), G334 (≠ A328), D335 (≠ G329), A336 (≠ I330), M411 (≠ V403), G429 (vs. gap), G430 (≠ T421)
- binding magnesium ion: D459 (= D450), N486 (= N477), E488 (≠ M479)
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
27% identity, 96% coverage: 14:548/558 of query aligns to 11:560/599 of 1n0hA
- active site: Y31 (≠ V34), G33 (= G36), G34 (≠ E37), A35 (≠ S38), I36 (≠ F39), E57 (= E60), T80 (= T83), F119 (= F122), Q120 (= Q123), E121 (= E124), K169 (≠ E172), R230 (≠ A227), M266 (≠ L263), V293 (≠ A290), V409 (≠ A398), L434 (≠ C422), G435 (= G423), M437 (= M425), D462 (= D450), N489 (= N477), E491 (≠ M479), Q492 (≠ Y480), M494 (≠ T482), V495 (≠ I483), W498 (≠ H486), L520 (≠ M508), G525 (= G513), L526 (≠ A514), K559 (≠ P547)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (≠ A398), G410 (= G399), Q411 (≠ N400), H412 (≠ Y401), G435 (= G423), M437 (= M425), G461 (= G449), D462 (= D450), A463 (≠ G451), S464 (≠ C452), M467 (= M455), N489 (= N477), E491 (≠ M479), Q492 (≠ Y480), G493 (= G481), V495 (≠ I483)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (≠ E37), A35 (≠ S38), V109 (≠ I112), P110 (≠ A113), F119 (= F122), K169 (≠ E172), M266 (≠ L263), D291 (= D288), R292 (≠ I289), V495 (≠ I483), W498 (≠ H486)
- binding flavin-adenine dinucleotide: R159 (= R162), G219 (= G217), A220 (vs. gap), G221 (= G218), N224 (≠ W221), T246 (≠ A243), L247 (≠ F244), Q248 (≠ R245), L264 (= L261), G265 (≠ S262), M266 (≠ L263), H267 (≠ G264), G286 (= G283), A287 (≠ T284), R288 (= R285), D290 (≠ G287), R292 (≠ I289), V293 (≠ A290), E319 (≠ H310), V320 (≠ A311), N324 (≠ E315), G337 (≠ A328), D338 (≠ G329), A339 (≠ I330), M414 (≠ V403), G432 (vs. gap), G433 (≠ T421)
- binding magnesium ion: D462 (= D450), N489 (= N477), E491 (≠ M479)
- binding thiamine diphosphate: Y31 (≠ V34), E57 (= E60), P83 (= P86)
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
27% identity, 96% coverage: 14:548/558 of query aligns to 9:557/596 of 1t9dA
- active site: Y29 (≠ V34), G31 (= G36), G32 (≠ E37), A33 (≠ S38), I34 (≠ F39), E55 (= E60), T78 (= T83), F117 (= F122), Q118 (= Q123), E119 (= E124), K167 (≠ E172), R227 (≠ A227), M263 (≠ L263), V290 (≠ A290), V406 (≠ A398), L431 (≠ C422), G432 (= G423), M434 (= M425), D459 (= D450), N486 (= N477), E488 (≠ M479), Q489 (≠ Y480), M491 (≠ T482), V492 (≠ I483), W495 (≠ H486), L517 (≠ M508), G522 (= G513), L523 (≠ A514), K556 (≠ P547)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ E37), A33 (≠ S38), V107 (≠ I112), P108 (≠ A113), F117 (= F122), K167 (≠ E172), M263 (≠ L263), D288 (= D288), R289 (≠ I289), W495 (≠ H486)
- binding flavin-adenine dinucleotide: R157 (= R162), G216 (= G217), A217 (vs. gap), G218 (= G218), N221 (≠ W221), T243 (≠ A243), L244 (≠ F244), Q245 (≠ R245), M260 (≠ H260), L261 (= L261), H264 (≠ G264), G283 (= G283), A284 (≠ T284), R285 (= R285), D287 (≠ G287), R289 (≠ I289), V290 (≠ A290), E316 (≠ H310), V317 (≠ A311), N321 (≠ E315), G334 (≠ A328), D335 (≠ G329), A336 (≠ I330), Q410 (≠ T402), M411 (≠ V403), G429 (vs. gap), G430 (≠ T421)
- binding magnesium ion: D459 (= D450), N486 (= N477), E488 (≠ M479)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E60), P81 (= P86), Q118 (= Q123), G432 (= G423), M434 (= M425), M464 (= M455)
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
27% identity, 96% coverage: 14:548/558 of query aligns to 10:558/597 of 1t9aA
- active site: Y30 (≠ V34), G32 (= G36), G33 (≠ E37), A34 (≠ S38), I35 (≠ F39), E56 (= E60), T79 (= T83), F118 (= F122), Q119 (= Q123), E120 (= E124), K168 (≠ E172), R228 (≠ A227), M264 (≠ L263), V291 (≠ A290), V407 (≠ A398), L432 (≠ C422), G433 (= G423), M435 (= M425), D460 (= D450), N487 (= N477), E489 (≠ M479), Q490 (≠ Y480), M492 (≠ T482), V493 (≠ I483), W496 (≠ H486), L518 (≠ M508), G523 (= G513), L524 (≠ A514), K557 (≠ P547)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (≠ E37), V108 (≠ I112), P109 (≠ A113), F118 (= F122), K168 (≠ E172), M264 (≠ L263), D289 (= D288), R290 (≠ I289), M492 (≠ T482), V493 (≠ I483), W496 (≠ H486)
- binding flavin-adenine dinucleotide: R158 (= R162), G217 (= G217), A218 (vs. gap), G219 (= G218), N222 (≠ W221), T244 (≠ A243), L245 (≠ F244), Q246 (≠ R245), L262 (= L261), M264 (≠ L263), H265 (≠ G264), G284 (= G283), A285 (≠ T284), R286 (= R285), D288 (≠ G287), R290 (≠ I289), V291 (≠ A290), E317 (≠ H310), V318 (≠ A311), N322 (≠ E315), G335 (≠ A328), D336 (≠ G329), A337 (≠ I330), Q411 (≠ T402), M412 (≠ V403), G430 (vs. gap), G431 (≠ T421)
- binding magnesium ion: D460 (= D450), N487 (= N477), E489 (≠ M479)
- binding propyl trihydrogen diphosphate: V407 (≠ A398), G408 (= G399), Q409 (≠ N400), H410 (≠ Y401), M435 (= M425), G459 (= G449), D460 (= D450), A461 (≠ G451), S462 (≠ C452), N487 (= N477), E489 (≠ M479), Q490 (≠ Y480), G491 (= G481), M492 (≠ T482)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G423), M435 (= M425), M465 (= M455)
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
27% identity, 96% coverage: 14:548/558 of query aligns to 9:556/595 of 1t9bB
- active site: Y29 (≠ V34), G31 (= G36), G32 (≠ E37), A33 (≠ S38), I34 (≠ F39), E55 (= E60), T78 (= T83), F117 (= F122), Q118 (= Q123), E119 (= E124), K167 (≠ E172), R226 (≠ A227), M262 (≠ L263), V289 (≠ A290), V405 (≠ A398), L430 (≠ C422), G431 (= G423), M433 (= M425), D458 (= D450), N485 (= N477), E487 (≠ M479), Q488 (≠ Y480), M490 (≠ T482), V491 (≠ I483), W494 (≠ H486), L516 (≠ M508), G521 (= G513), L522 (≠ A514), K555 (≠ P547)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (≠ I112), P108 (≠ A113), D287 (= D288), R288 (≠ I289), M490 (≠ T482), W494 (≠ H486)
- binding flavin-adenine dinucleotide: R157 (= R162), G215 (= G217), A216 (vs. gap), G217 (= G218), N220 (≠ W221), T242 (≠ A243), L243 (≠ F244), Q244 (≠ R245), M259 (≠ H260), L260 (= L261), M262 (≠ L263), H263 (≠ G264), G282 (= G283), A283 (≠ T284), R284 (= R285), D286 (≠ G287), R288 (≠ I289), V289 (≠ A290), E315 (≠ H310), V316 (≠ A311), N320 (≠ E315), G333 (≠ A328), D334 (≠ G329), A335 (≠ I330), Q409 (≠ T402), M410 (≠ V403), G428 (vs. gap), G429 (≠ T421)
- binding magnesium ion: D458 (= D450), N485 (= N477), E487 (≠ M479)
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
27% identity, 96% coverage: 14:548/558 of query aligns to 13:568/607 of 6u9dB
- active site: Y33 (≠ V34), G35 (= G36), G36 (≠ E37), A37 (≠ S38), I38 (≠ F39), E59 (= E60), T82 (= T83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (≠ E172), M274 (≠ L263), V301 (≠ A290), V417 (≠ A398), G443 (= G423), M445 (= M425), D470 (= D450), N497 (= N477), E499 (≠ M479), Q500 (≠ Y480), M502 (≠ T482), V503 (≠ I483), W506 (≠ H486)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (≠ E37), V111 (≠ I112), P112 (≠ A113), F121 (= F122), K171 (≠ E172), D299 (= D288), R300 (≠ I289), M502 (≠ T482), W506 (≠ H486)
- binding flavin-adenine dinucleotide: R161 (= R162), A228 (vs. gap), G229 (= G218), N232 (≠ W221), T254 (≠ A243), L255 (≠ F244), Q256 (≠ R245), L272 (= L261), M274 (≠ L263), G294 (= G283), R296 (= R285), D298 (≠ G287), R300 (≠ I289), V301 (≠ A290), E327 (≠ H310), V328 (≠ A311), N332 (≠ E315), D346 (≠ G329), A347 (≠ I330), M422 (≠ V403), G440 (vs. gap), G441 (≠ T421)
- binding magnesium ion: D470 (= D450), N497 (= N477)
- binding thiamine diphosphate: E59 (= E60), P85 (= P86), V417 (≠ A398), G418 (= G399), Q419 (≠ N400), H420 (≠ Y401), G443 (= G423), M445 (= M425), A471 (≠ G451), S472 (≠ C452), N497 (= N477), E499 (≠ M479), Q500 (≠ Y480), G501 (= G481), M502 (≠ T482), V503 (≠ I483)
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
27% identity, 96% coverage: 14:548/558 of query aligns to 93:648/687 of P07342
- R241 (= R162) binding
- 355:376 (vs. 264:285, 32% identical) binding
- 407:426 (vs. 310:329, 15% identical) binding
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
28% identity, 95% coverage: 13:544/558 of query aligns to 12:555/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (vs. gap), R292 (≠ I289), W489 (≠ H486)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ A398), G401 (= G399), Q402 (≠ N400), H403 (≠ Y401), G426 (= G423), M428 (= M425), G452 (= G449), D453 (= D450), G454 (= G451), S455 (≠ C452), L483 (≠ Y480), G484 (= G481), M485 (≠ T482), V486 (≠ I483)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G217), G223 (= G218), G224 (≠ A219), T246 (≠ A243), L247 (≠ F244), M248 (≠ R245), M263 (≠ Y257), L264 (≠ V258), M266 (vs. gap), H267 (= H260), G286 (= G283), R288 (= R285), V293 (≠ A290), D310 (≠ H310), I311 (≠ A311), D329 (vs. gap), V330 (≠ I326), M405 (≠ V403), G423 (vs. gap)
- binding magnesium ion: A37 (≠ S38), T82 (= T83), S83 (≠ R84), Q122 (= Q123), Y381 (≠ A379), D453 (= D450), M458 (= M455), Q461 (= Q458), N480 (= N477), H482 (≠ M479), K533 (≠ T522)
Sites not aligning to the query:
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
28% identity, 95% coverage: 13:544/558 of query aligns to 97:640/670 of P17597
- A122 (≠ S38) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ L40) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E60) binding
- S186 (= S102) binding
- P197 (≠ A113) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ G115) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q123) binding
- K220 (= K136) binding
- R246 (= R162) binding ; binding
- K256 (≠ E172) binding
- G308 (= G218) binding
- TL 331:332 (≠ AF 243:244) binding
- C340 (vs. gap) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (≠ VG-H 258:260) binding
- GVRFD 371:375 (≠ GTRLG 283:287) binding
- DR 376:377 (≠ DI 288:289) binding
- DI 395:396 (≠ HA 310:311) binding
- DV 414:415 (≠ -I 326) binding
- QH 487:488 (≠ NY 400:401) binding
- GG 508:509 (≠ -T 421) binding
- GAM 511:513 (= GAM 423:425) binding
- D538 (= D450) binding
- DGS 538:540 (≠ DGC 450:452) binding
- N565 (= N477) binding
- NQHLGM 565:570 (≠ NGMYGT 477:482) binding
- H567 (≠ M479) binding
- W574 (≠ H486) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
Sites not aligning to the query:
- 653 binding ; S→A: No effect on catalytic activity or sensitivity to herbicides.; S→F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; S→N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; S→T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
28% identity, 95% coverage: 13:544/558 of query aligns to 12:555/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ A398), G401 (= G399), Q402 (≠ N400), H403 (≠ Y401), G426 (= G423), M428 (= M425), G452 (= G449), D453 (= D450), G454 (= G451), S455 (≠ C452), M458 (= M455), N480 (= N477), H482 (≠ M479), L483 (≠ Y480), G484 (= G481), M485 (≠ T482), V486 (≠ I483)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G217), G223 (= G218), G224 (≠ A219), T246 (≠ A243), L247 (≠ F244), M248 (≠ R245), L264 (≠ V258), M266 (vs. gap), H267 (= H260), G286 (= G283), V287 (≠ T284), R288 (= R285), D290 (≠ G287), R292 (≠ I289), V293 (≠ A290), D310 (≠ H310), I311 (≠ A311), D329 (vs. gap), V330 (≠ I326), M405 (≠ V403), G423 (vs. gap)
- binding magnesium ion: F370 (≠ A366), D453 (= D450), M458 (= M455), Q461 (= Q458), N480 (= N477), H482 (≠ M479), K533 (≠ T522)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (vs. gap), R292 (≠ I289), M485 (≠ T482), W489 (≠ H486)
Sites not aligning to the query:
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
28% identity, 95% coverage: 13:544/558 of query aligns to 12:555/582 of 5wj1A
- active site: Y33 (≠ V34), G35 (= G36), G36 (≠ E37), A37 (≠ S38), S38 (≠ F39), E59 (= E60), T82 (= T83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (≠ E172), M266 (vs. gap), V293 (≠ A290), V400 (≠ A398), G426 (= G423), M428 (= M425), D453 (= D450), N480 (= N477), H482 (≠ M479), L483 (≠ Y480), M485 (≠ T482), V486 (≠ I483), W489 (≠ H486)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G217), G223 (= G218), G224 (≠ A219), T246 (≠ A243), L247 (≠ F244), M248 (≠ R245), M263 (≠ Y257), L264 (≠ V258), G286 (= G283), R288 (= R285), V293 (≠ A290), D310 (≠ H310), I311 (≠ A311), D329 (vs. gap), V330 (≠ I326), M405 (≠ V403), G423 (vs. gap), G424 (≠ T421)
- binding magnesium ion: D453 (= D450), N480 (= N477), H482 (≠ M479)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (vs. gap), D291 (= D288), R292 (≠ I289), M485 (≠ T482), W489 (≠ H486)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ A398), G401 (= G399), Q402 (≠ N400), H403 (≠ Y401), M428 (= M425), D453 (= D450), G454 (= G451), S455 (≠ C452), M458 (= M455), N480 (= N477), H482 (≠ M479), L483 (≠ Y480), G484 (= G481), M485 (≠ T482), V486 (≠ I483)
Sites not aligning to the query:
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
28% identity, 95% coverage: 13:544/558 of query aligns to 12:555/582 of 5k6tA
- active site: Y33 (≠ V34), G35 (= G36), G36 (≠ E37), A37 (≠ S38), S38 (≠ F39), E59 (= E60), T82 (= T83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (≠ E172), M266 (vs. gap), V293 (≠ A290), V400 (≠ A398), G426 (= G423), M428 (= M425), D453 (= D450), N480 (= N477), H482 (≠ M479), L483 (≠ Y480), M485 (≠ T482), V486 (≠ I483), W489 (≠ H486)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H260), R292 (≠ I289), M485 (≠ T482), W489 (≠ H486)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G217), G223 (= G218), G224 (≠ A219), T246 (≠ A243), L247 (≠ F244), M248 (≠ R245), L264 (≠ V258), G286 (= G283), R288 (= R285), D290 (≠ G287), R292 (≠ I289), V293 (≠ A290), D310 (≠ H310), I311 (≠ A311), D329 (vs. gap), V330 (≠ I326), Q404 (≠ T402), M405 (≠ V403), G423 (vs. gap)
- binding magnesium ion: D453 (= D450), N480 (= N477), H482 (≠ M479)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ A398), G401 (= G399), Q402 (≠ N400), H403 (≠ Y401), G426 (= G423), M428 (= M425), G452 (= G449), G454 (= G451), S455 (≠ C452), N480 (= N477), H482 (≠ M479), L483 (≠ Y480), G484 (= G481)
Sites not aligning to the query:
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
28% identity, 95% coverage: 13:544/558 of query aligns to 12:555/582 of 5k6rA
- active site: Y33 (≠ V34), G35 (= G36), G36 (≠ E37), A37 (≠ S38), S38 (≠ F39), E59 (= E60), T82 (= T83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (≠ E172), M266 (vs. gap), V293 (≠ A290), V400 (≠ A398), G426 (= G423), M428 (= M425), D453 (= D450), N480 (= N477), H482 (≠ M479), L483 (≠ Y480), M485 (≠ T482), V486 (≠ I483), W489 (≠ H486)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (≠ I289), W489 (≠ H486)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G217), G223 (= G218), G224 (≠ A219), T246 (≠ A243), L247 (≠ F244), M248 (≠ R245), L264 (≠ V258), M266 (vs. gap), G286 (= G283), R288 (= R285), R292 (≠ I289), V293 (≠ A290), D310 (≠ H310), I311 (≠ A311), G328 (vs. gap), D329 (vs. gap), V330 (≠ I326), M405 (≠ V403), G423 (vs. gap)
- binding magnesium ion: D453 (= D450), N480 (= N477), H482 (≠ M479)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ A398), G401 (= G399), Q402 (≠ N400), H403 (≠ Y401), G426 (= G423), M428 (= M425), D453 (= D450), G454 (= G451), S455 (≠ C452), M458 (= M455), N480 (= N477), H482 (≠ M479), L483 (≠ Y480), G484 (= G481), M485 (≠ T482), V486 (≠ I483)
Sites not aligning to the query:
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
28% identity, 95% coverage: 13:544/558 of query aligns to 12:555/582 of 1z8nA
- active site: Y33 (≠ V34), G35 (= G36), G36 (≠ E37), A37 (≠ S38), S38 (≠ F39), E59 (= E60), T82 (= T83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (≠ E172), M266 (vs. gap), V293 (≠ A290), V400 (≠ A398), G426 (= G423), M428 (= M425), D453 (= D450), N480 (= N477), H482 (≠ M479), L483 (≠ Y480), M485 (≠ T482), V486 (≠ I483), W489 (≠ H486)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K136), R161 (= R162), Y191 (≠ R186), R194 (≠ P189), D291 (= D288), R292 (≠ I289), D312 (= D312), W489 (≠ H486)
- binding flavin-adenine dinucleotide: R161 (= R162), G222 (= G217), G224 (≠ A219), T246 (≠ A243), L247 (≠ F244), M248 (≠ R245), L264 (≠ V258), G265 (= G259), M266 (vs. gap), H267 (= H260), G286 (= G283), V287 (≠ T284), R288 (= R285), D290 (≠ G287), R292 (≠ I289), V293 (≠ A290), D310 (≠ H310), I311 (≠ A311), D329 (vs. gap), V330 (≠ I326), M405 (≠ V403), G423 (vs. gap), G424 (≠ T421)
- binding magnesium ion: D453 (= D450), N480 (= N477)
- binding thiamine diphosphate: V400 (≠ A398), G401 (= G399), Q402 (≠ N400), H403 (≠ Y401), G426 (= G423), M428 (= M425), G452 (= G449), G454 (= G451), S455 (≠ C452), N480 (= N477), H482 (≠ M479), L483 (≠ Y480), G484 (= G481), M485 (≠ T482), V486 (≠ I483)
Sites not aligning to the query:
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
28% identity, 95% coverage: 13:544/558 of query aligns to 12:555/582 of 1yi1A
- active site: Y33 (≠ V34), G35 (= G36), G36 (≠ E37), A37 (≠ S38), S38 (≠ F39), E59 (= E60), T82 (= T83), F121 (= F122), Q122 (= Q123), E123 (= E124), K171 (≠ E172), M266 (vs. gap), V293 (≠ A290), V400 (≠ A398), G426 (= G423), M428 (= M425), D453 (= D450), N480 (= N477), H482 (≠ M479), L483 (≠ Y480), M485 (≠ T482), V486 (≠ I483), W489 (≠ H486)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D288), R292 (≠ I289), W489 (≠ H486)
- binding flavin-adenine dinucleotide: R161 (= R162), G223 (= G218), G224 (≠ A219), T246 (≠ A243), L247 (≠ F244), M248 (≠ R245), M263 (≠ Y257), L264 (≠ V258), G265 (= G259), M266 (vs. gap), H267 (= H260), G286 (= G283), V287 (≠ T284), R288 (= R285), D290 (≠ G287), V293 (≠ A290), D310 (≠ H310), I311 (≠ A311), D329 (vs. gap), V330 (≠ I326), M405 (≠ V403), G423 (vs. gap), G424 (≠ T421)
- binding magnesium ion: D453 (= D450), N480 (= N477), H482 (≠ M479)
Sites not aligning to the query:
Query Sequence
>RR42_RS29140 FitnessBrowser__Cup4G11:RR42_RS29140
MPSTSSSAKPAARSGGRVLVDALRIHGAQRIFCVPGESFLDVLDALHDQPAIDLIVCKHE
GAAANMAEADGKLTGRPGICFVTRGPGATHASIGVHIAAQDSTPMLLFVGQIARGHKGRE
AFQEVDYGAMFGSIAKWVVEIEDPARIPELVARAFQCATSGRPGPVVISLPEDVLDGLCE
VADTGRYRPVAAAPRAADADALAAALAGAERPLVIAGGANWSAQAAADFAAFVQRWNLPV
ACAFRRQDVFDNRDPHYVGHLSLGVNPALAERVRTADVILAFGTRLGDIATDGYTLLEAP
QPRQRLFHLHADSAELGRVYQPELAIHAGIEPGAAMLAALTPPAAVRWGDWTSAARAAHG
AFVAPAKPHPQLTGVDMGAVVAHLDRILPDDAVLTNGAGNYTVWLHRYYAYRQPRTELAP
TCGAMGYGLPAAVAAKLRDPQRTVVCFAGDGCFLMYPQELATAAQYGANLIVVVVNNGMY
GTIRMHQEKRYPGRVSGTDIPSPDFVAMARSCGAWAERVTQTEDFAAAFARAQAAGKPAV
LELVTDPRQITPAMRIAD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory