Comparing RR42_RS29645 FitnessBrowser__Cup4G11:RR42_RS29645 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
56% identity, 95% coverage: 10:198/199 of query aligns to 72:259/260 of P02911
Sites not aligning to the query:
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
56% identity, 95% coverage: 10:198/199 of query aligns to 50:237/238 of 1lstA
Sites not aligning to the query:
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
56% identity, 95% coverage: 10:198/199 of query aligns to 50:237/238 of 1lahE
Sites not aligning to the query:
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
56% identity, 95% coverage: 10:198/199 of query aligns to 50:237/238 of 1lagE
Sites not aligning to the query:
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
56% identity, 95% coverage: 10:198/199 of query aligns to 50:237/238 of 1lafE
Sites not aligning to the query:
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
54% identity, 95% coverage: 9:198/199 of query aligns to 71:259/260 of P0AEU0
Sites not aligning to the query:
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
55% identity, 95% coverage: 10:198/199 of query aligns to 47:234/235 of 5owfA
Sites not aligning to the query:
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
54% identity, 95% coverage: 9:198/199 of query aligns to 71:259/260 of P02910
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
54% identity, 95% coverage: 9:198/199 of query aligns to 49:237/238 of 1hslA
Sites not aligning to the query:
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
36% identity, 94% coverage: 6:192/199 of query aligns to 46:225/226 of 4zv1A
Sites not aligning to the query:
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
36% identity, 94% coverage: 6:192/199 of query aligns to 46:223/225 of 4zv2A
Sites not aligning to the query:
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
32% identity, 94% coverage: 5:192/199 of query aligns to 41:225/225 of 3tqlA
Sites not aligning to the query:
8hqrA Crystal structure of the arginine-/lysine-binding protein sar11_1210 from 'candidatus pelagibacter ubique' htcc1062 bound to arginine
33% identity, 97% coverage: 3:195/199 of query aligns to 47:264/267 of 8hqrA
Sites not aligning to the query:
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
33% identity, 92% coverage: 11:193/199 of query aligns to 57:228/229 of 6svfA
Sites not aligning to the query:
5itoA Structure of the periplasmic binding protein m117n-noct from a. Tumefaciens in complex with octopine (see paper)
29% identity, 94% coverage: 9:195/199 of query aligns to 48:252/255 of 5itoA
Sites not aligning to the query:
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
29% identity, 94% coverage: 9:195/199 of query aligns to 47:251/256 of 5otcA
Sites not aligning to the query:
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
29% identity, 94% coverage: 9:195/199 of query aligns to 48:252/259 of 5ovzA
Sites not aligning to the query:
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
29% identity, 94% coverage: 9:195/199 of query aligns to 47:251/254 of 5otaA
Sites not aligning to the query:
5ot9A Structure of the periplasmic binding protein (pbp) noct from a.Tumefaciens c58 in complex with histopine. (see paper)
29% identity, 94% coverage: 9:195/199 of query aligns to 47:251/254 of 5ot9A
Sites not aligning to the query:
4powA Structure of the pbp noct in complex with pyronopaline (see paper)
29% identity, 94% coverage: 9:195/199 of query aligns to 47:251/254 of 4powA
Sites not aligning to the query:
>RR42_RS29645 FitnessBrowser__Cup4G11:RR42_RS29645
RSRSSEIRKNSFDGMIPALQARKFDAINSSMSKNEQRLKVIDFTSKLYAPIEALVVKKGS
PLVATAESLKGKRVGVLQGSTQETYARKYWGGNGVDIVPYQTQDLIWPDLIAGRIDAAMA
FAPQADAGFLKTPPGKDFVFAQGPAIKDDSIFGPGVSIGVRKDDTALRDAINGAIDSLRK
DGTYDKIAKKYFNFNIYGS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory