Comparing RR42_RS29660 FitnessBrowser__Cup4G11:RR42_RS29660 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
68% identity, 96% coverage: 12:264/264 of query aligns to 6:258/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
68% identity, 96% coverage: 12:264/264 of query aligns to 2:254/258 of 1b0uA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
55% identity, 95% coverage: 13:263/264 of query aligns to 2:240/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
52% identity, 94% coverage: 13:260/264 of query aligns to 4:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
52% identity, 94% coverage: 13:260/264 of query aligns to 4:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
52% identity, 94% coverage: 13:260/264 of query aligns to 4:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
52% identity, 94% coverage: 13:260/264 of query aligns to 4:239/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
51% identity, 95% coverage: 13:263/264 of query aligns to 3:240/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 90% coverage: 26:263/264 of query aligns to 19:245/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 90% coverage: 26:263/264 of query aligns to 20:246/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 90% coverage: 26:263/264 of query aligns to 20:246/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 90% coverage: 26:263/264 of query aligns to 20:246/344 of 6cvlD
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
41% identity, 78% coverage: 13:218/264 of query aligns to 4:202/226 of 5xu1B
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
42% identity, 80% coverage: 13:222/264 of query aligns to 4:202/223 of 2pclA
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
40% identity, 88% coverage: 28:258/264 of query aligns to 21:232/232 of 1f3oA
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
35% identity, 95% coverage: 11:262/264 of query aligns to 16:266/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
35% identity, 95% coverage: 11:262/264 of query aligns to 16:266/382 of 7aheC
Sites not aligning to the query:
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
41% identity, 81% coverage: 28:240/264 of query aligns to 21:226/230 of 1l2tA
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
36% identity, 96% coverage: 9:261/264 of query aligns to 1:253/648 of P75831
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
40% identity, 76% coverage: 26:226/264 of query aligns to 22:211/650 of 5ws4A
>RR42_RS29660 FitnessBrowser__Cup4G11:RR42_RS29660
MLMKTTQAMSCKLAVQDIHKSFGDNEVLKGVSLTAKKGDVISIIGASGSGKSTFLRCINY
LERPKSGQIFLDGEEIRTKKDKTGDLVVVEPKQLQRMRTKLSMVFQHFNLWAHMNVLENI
IEAPTHVLGLSRKEAEERAREYLEKVGLPPRVEKQYPSHLSGGQQQRVAIARALAMNPDV
MLFDEPTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRTEEQ
GPPEEVLNSPRSERLRQFLSGSLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory