SitesBLAST
Comparing RR42_RS29670 FitnessBrowser__Cup4G11:RR42_RS29670 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q88H32 Ornithine cyclodeaminase; OCD; EC 4.3.1.12 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
61% identity, 91% coverage: 18:337/353 of query aligns to 13:334/350 of Q88H32
- R45 (= R50) binding
- K69 (= K74) binding
- T84 (= T89) binding
- R112 (= R117) binding ; binding
- AQ 139:140 (= AQ 144:145) binding
- D161 (= D166) binding
- T202 (= T206) binding
- VGGD 225:228 (= VGGD 229:232) binding
- D228 (= D232) binding
- K232 (= K236) binding
- S293 (= S297) binding
- V294 (= V298) binding
- K331 (= K334) binding
1x7dA Crystal structure analysis of ornithine cyclodeaminase complexed with NAD and ornithine to 1.6 angstroms (see paper)
61% identity, 91% coverage: 18:337/353 of query aligns to 12:333/340 of 1x7dA
- active site: E55 (= E61), D227 (= D232)
- binding nicotinamide-adenine-dinucleotide: T83 (= T89), R111 (= R117), T112 (= T118), G137 (= G143), A138 (= A144), Q139 (= Q145), D160 (= D166), T161 (≠ V167), V200 (= V205), T201 (= T206), A202 (= A207), I209 (= I214), V224 (= V229), G225 (= G230), D227 (= D232), K231 (= K236), S292 (= S297), V293 (= V298), G294 (= G299)
- binding L-ornithine: R44 (= R50), V53 (= V59), E55 (= E61), M57 (= M63), K68 (= K74), V70 (= V76), N71 (= N77), G72 (= G78), R111 (= R117), D227 (= D232), V293 (= V298)
1u7hA Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida (see paper)
61% identity, 91% coverage: 18:337/353 of query aligns to 12:333/341 of 1u7hA
- active site: E55 (= E61), D227 (= D232)
- binding nicotinamide-adenine-dinucleotide: T83 (= T89), R111 (= R117), T112 (= T118), G137 (= G143), A138 (= A144), Q139 (= Q145), D160 (= D166), T161 (≠ V167), V200 (= V205), T201 (= T206), A202 (= A207), I209 (= I214), V224 (= V229), G225 (= G230), D227 (= D232), K231 (= K236), S292 (= S297), V293 (= V298), G294 (= G299)
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
34% identity, 72% coverage: 72:326/353 of query aligns to 63:319/320 of 1omoA
- active site: D219 (= D232)
- binding nicotinamide-adenine-dinucleotide: T109 (= T118), G134 (= G143), T135 (≠ A144), Q136 (= Q145), Y156 (= Y165), D157 (= D166), V158 (= V167), R159 (≠ D168), T195 (= T206), P196 (≠ A207), G217 (= G230), D219 (= D232), K223 (= K236), S290 (= S297), T291 (≠ V298), G292 (= G299)
Sites not aligning to the query:
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
34% identity, 72% coverage: 72:326/353 of query aligns to 63:319/322 of O28608
5gziA Cyclodeaminase_pa
34% identity, 75% coverage: 58:321/353 of query aligns to 64:329/354 of 5gziA
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ G78), T97 (= T89), R125 (= R117), T126 (= T118), G151 (= G143), A152 (= A144), Q153 (= Q145), D174 (= D166), T175 (≠ V167), H179 (≠ A171), A212 (≠ V205), T213 (= T206), S214 (≠ A207), V215 (≠ D208), V237 (= V229), G238 (= G230), A239 (≠ G231), S305 (= S297), T306 (≠ V298), G307 (= G299)
- binding (2S)-piperidine-2-carboxylic acid: K81 (= K74), R125 (= R117), A239 (≠ G231), T306 (≠ V298), G307 (= G299)
Sites not aligning to the query:
5gzlA Cyclodeaminase_pa
34% identity, 75% coverage: 58:321/353 of query aligns to 64:329/357 of 5gzlA
- binding lysine: I65 (≠ V59), E67 (= E61), D240 (= D232), R267 (≠ I259), E268 (= E260)
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ G78), T97 (= T89), I98 (≠ V90), T126 (= T118), G151 (= G143), A152 (= A144), Q153 (= Q145), D174 (= D166), T175 (≠ V167), H179 (≠ A171), A212 (≠ V205), T213 (= T206), S214 (≠ A207), V222 (≠ I215), V237 (= V229), G238 (= G230), A239 (≠ G231), D240 (= D232), K244 (= K236), S305 (= S297), T306 (≠ V298), G307 (= G299)
Sites not aligning to the query:
5yu4A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
34% identity, 75% coverage: 58:321/353 of query aligns to 60:325/344 of 5yu4A
- binding 2,4-diaminobutyric acid: E63 (= E61), K77 (= K74), R121 (= R117), T302 (≠ V298), G303 (= G299)
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ G78), T93 (= T89), I94 (≠ V90), R121 (= R117), T122 (= T118), G147 (= G143), A148 (= A144), Q149 (= Q145), D170 (= D166), T171 (≠ V167), H175 (≠ A171), A208 (≠ V205), T209 (= T206), S210 (≠ A207), V211 (≠ D208), V218 (≠ I215), V233 (= V229), A235 (≠ G231), S301 (= S297), T302 (≠ V298), G303 (= G299)
5yu3A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
34% identity, 75% coverage: 58:321/353 of query aligns to 60:325/344 of 5yu3A
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ G78), T93 (= T89), I94 (≠ V90), T122 (= T118), G147 (= G143), A148 (= A144), Q149 (= Q145), D170 (= D166), T171 (≠ V167), A208 (≠ V205), T209 (= T206), S210 (≠ A207), V211 (≠ D208), V233 (= V229), A235 (≠ G231), S301 (= S297), T302 (≠ V298), G303 (= G299)
- binding proline: M65 (= M63), K77 (= K74), R121 (= R117)
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
29% identity, 91% coverage: 7:326/353 of query aligns to 1:325/325 of 6t3eB
- binding 1,4-dihydronicotinamide adenine dinucleotide: S82 (≠ T89), T111 (= T118), G136 (= G143), V137 (≠ A144), Q138 (= Q145), D159 (= D166), I160 (≠ V167), A199 (= A207), T200 (≠ D208), T201 (≠ K209), A202 (≠ T210), V206 (≠ I214), V221 (= V229), G222 (= G230), W223 (≠ G231), S296 (= S297), V297 (= V298), G298 (= G299)
- binding proline: R39 (vs. gap), M54 (= M63), K67 (= K74), R110 (= R117)
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
31% identity, 65% coverage: 87:317/353 of query aligns to 80:303/303 of 4bv9A
- active site: S220 (≠ D232)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S82 (≠ T89), H83 (≠ V90), T111 (= T118), G134 (= G141), G136 (= G143), V137 (≠ A144), Q138 (= Q145), N159 (≠ D166), R160 (≠ V167), T161 (≠ D168), V195 (= V205), T196 (= T206), M197 (≠ K209), A198 (≠ T210), V217 (= V229), G218 (= G230), S283 (= S297), L284 (≠ V298), G285 (= G299)
- binding pyruvic acid: R110 (= R117)
Sites not aligning to the query:
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
32% identity, 63% coverage: 95:317/353 of query aligns to 87:302/303 of 4bvaA
- active site: S219 (≠ D232)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T106 (= T114), R109 (= R117), T110 (= T118), G135 (= G143), V136 (≠ A144), Q137 (= Q145), N158 (≠ D166), R159 (≠ V167), T160 (≠ D168), N163 (≠ A171), V194 (= V205), T195 (= T206), M196 (≠ A207), A197 (≠ T210), V216 (= V229), S282 (= S297), L283 (≠ V298), G284 (= G299)
- binding 3,5,3'triiodothyronine: S219 (≠ D232), R220 (≠ C233), W223 (≠ K236), E247 (≠ I259)
Sites not aligning to the query:
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
29% identity, 74% coverage: 58:317/353 of query aligns to 56:311/312 of 2i99A
- active site: G59 (≠ E61), S228 (≠ D232)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D81 (vs. gap), S90 (≠ T89), H91 (≠ V90), R118 (= R117), T119 (= T118), G142 (= G141), A143 (≠ N142), G144 (= G143), V145 (≠ A144), Q146 (= Q145), N167 (≠ D166), R168 (≠ V167), T169 (≠ D168), V203 (= V205), T204 (= T206), L205 (≠ A207), A206 (≠ T210), V225 (= V229), G226 (= G230), S291 (= S297), L292 (≠ V298), G293 (= G299)
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
29% identity, 74% coverage: 58:317/353 of query aligns to 57:312/314 of Q14894
4mp6A Staphyloferrin b precursor biosynthetic enzyme sbnb bound to citrate and NAD+ (see paper)
25% identity, 66% coverage: 95:326/353 of query aligns to 98:333/334 of 4mp6A
- active site: M236 (≠ T237)
- binding nicotinamide-adenine-dinucleotide: R120 (= R117), T121 (= T118), G146 (= G143), L147 (vs. gap), I148 (vs. gap), D170 (= D166), Q171 (≠ V167), C211 (≠ V205), T212 (= T206), V213 (≠ A207), I233 (≠ V229), G306 (= G299)
Sites not aligning to the query:
4mpdA Staphyloferrin b precursor biosynthetic enzyme sbnb bound a- ketoglutarate and NAD+ (see paper)
26% identity, 66% coverage: 95:326/353 of query aligns to 86:317/318 of 4mpdA
Sites not aligning to the query:
4m54A The structure of the staphyloferrin b precursor biosynthetic enzyme sbnb bound to n-(1-amino-1-carboxyl-2-ethyl)-glutamic acid and nadh (see paper)
25% identity, 66% coverage: 95:326/353 of query aligns to 93:309/310 of 4m54A
Sites not aligning to the query:
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
29% identity, 61% coverage: 111:326/353 of query aligns to 106:322/322 of 6rqaB
- binding nicotinamide-adenine-dinucleotide: T113 (= T118), G138 (= G143), Q140 (= Q145), P162 (≠ V167), H163 (≠ D168), I199 (≠ A207), T200 (≠ D208), S201 (≠ K209), S202 (≠ T210), M221 (≠ V229), G222 (= G230), D224 (= D232), K228 (= K236), G293 (≠ S297), T294 (≠ V298), G295 (= G299)
Sites not aligning to the query:
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
29% identity, 61% coverage: 111:326/353 of query aligns to 106:322/322 of 6rqaA
- binding nicotinamide-adenine-dinucleotide: T113 (= T118), G138 (= G143), H139 (≠ A144), Q140 (= Q145), N161 (≠ D166), P162 (≠ V167), H163 (≠ D168), M166 (≠ L175), I199 (≠ A207), T200 (≠ D208), S201 (≠ K209), S202 (≠ T210), M221 (≠ V229), G222 (= G230), D224 (= D232), K228 (= K236), G293 (≠ S297)
Sites not aligning to the query:
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
29% identity, 61% coverage: 111:326/353 of query aligns to 104:320/320 of A1B8Z0
Query Sequence
>RR42_RS29670 FitnessBrowser__Cup4G11:RR42_RS29670
MSNTLPLIHLSPNDVVRLVHRIGLPQCIAGVAERIEQDFLRWSEFDKSARVASHSPDGVV
ELMPIADATQFAFKYVNGHPKNTTLGLPTVMAFGVLADVATGAPIMLSELTLTTAIRTAA
MSSLAARTLARPGCRTMALIGNGAQSEFQAMAFRHLLNIQSIRLYDVDKAATNKLLSNLE
GFGLDLVVCNSAAEAALGADIITTVTADKTNATIISPEMVTPGVHINAVGGDCPGKTELH
RGVLEMGKVFVEYEPQSRIEGDIQQMAADFPVTELWRVLTGHVPARHSASQITIFDSVGF
ALEDYSALTFLYEKARSYGFGRDLALIPALNDPKNLFGALELASIAPEPSLVD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory