SitesBLAST
Comparing RR42_RS29835 FitnessBrowser__Cup4G11:RR42_RS29835 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
24% identity, 80% coverage: 70:424/445 of query aligns to 63:433/446 of A0A0H2VG78
- R102 (= R117) mutation to A: Loss of transport activity.
- I105 (≠ Q120) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E137) mutation to A: Loss of transport activity.
- Q137 (≠ G152) mutation to A: Loss of transport activity.
- Q250 (≠ S244) mutation to A: Loss of transport activity.
- Q251 (≠ H245) mutation to A: Loss of transport activity.
- N256 (≠ Y250) mutation to A: Loss of transport activity.
- W357 (≠ F347) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
27% identity, 62% coverage: 22:297/445 of query aligns to 56:315/444 of Q8NLB7
- D57 (= D23) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R75) mutation to A: Loss of transport activity.
- W309 (≠ A291) mutation to V: Loss of transport activity.
- D312 (= D294) mutation to A: Loss of transport activity.
- R313 (= R295) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 37% coverage: 64:227/445 of query aligns to 98:268/583 of Q9Y7Q9
- S267 (≠ E226) modified: Phosphoserine
Sites not aligning to the query:
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 51% coverage: 7:231/445 of query aligns to 63:301/587 of P25297
- K298 (≠ L228) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Sites not aligning to the query:
- 6 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
22% identity, 38% coverage: 56:225/445 of query aligns to 195:361/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
22% identity, 38% coverage: 56:225/445 of query aligns to 195:361/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
8fvzA Pipt y150a
24% identity, 95% coverage: 13:435/445 of query aligns to 9:433/433 of 8fvzA
Query Sequence
>RR42_RS29835 FitnessBrowser__Cup4G11:RR42_RS29835
QRVRDVLKPISGAAVGNMLEWFDYSLYGYLSATLAKVFFPSSDPIVSLIAAFAAFSVAFV
TRPLGALFFGSLGDRLGRRDTLAIVVGLISVSTGLVGVLPGYEAIGIAAPLLLVALRMIQ
GFSAGGEAGGALAFLAEYAPTRRRGVVIGFFGMSAGIGALSGSGLVLAITSIFGQTAVEA
WAWRLPFLIAGPIGLGAFWLRLRIEETPAFRLHLEREGAAQAPLREALRDDWRSIVKCLG
VAISHGIPYYLILAYLPSYLVSTGRLSSGQALAASGLAFLGSVIVIPFAAALSDRVGRRP
VAFTAALAYLVVALPLFRIVVGSTPEVVIATMASVGVLMGMYGSAPFCMMTELFPTRTRY
SAMSVGYNVAMVLFGGTAPLISASLTKLTGNPSSPAYFMMGGAVLSIFAILASPETSRVP
IDELGQSDEHIRRVRMALKASARVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory