SitesBLAST
Comparing RR42_RS29850 FitnessBrowser__Cup4G11:RR42_RS29850 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
34% identity, 99% coverage: 1:367/369 of query aligns to 1:374/422 of P16640
- A15 (= A15) binding
- D37 (≠ K37) binding
- K50 (= K50) binding
- V83 (≠ A83) binding
- R134 (= R130) binding
- D284 (= D275) binding
- V302 (≠ R293) binding
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
34% identity, 99% coverage: 2:367/369 of query aligns to 1:373/422 of 1q1wA
- active site: L13 (≠ A14), L44 (≠ R45), P45 (= P46), L305 (≠ S297)
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (≠ S13), L13 (≠ A14), A14 (= A15), G35 (= G36), D36 (≠ K37), L44 (≠ R45), P45 (= P46), K49 (= K50), V82 (≠ A83), A108 (= A109), T109 (= T110), G110 (= G111), R133 (= R130), I159 (= I156), D283 (= D275), S300 (≠ H292), V301 (≠ R293), W329 (= W321)
6tukB Crystal structure of fdr9 (see paper)
35% identity, 93% coverage: 5:347/369 of query aligns to 2:337/393 of 6tukB
- binding flavin-adenine dinucleotide: V7 (= V10), G8 (= G11), G9 (≠ A12), G10 (≠ S13), A12 (= A15), A34 (≠ K37), E35 (= E38), R42 (= R45), P43 (= P46), K47 (= K50), A75 (≠ S82), A76 (= A83), T102 (= T110), G103 (= G111), V118 (≠ L129), R119 (= R130), G259 (= G274), D260 (= D275), H277 (= H292), W278 (≠ R293), F311 (= F320), W312 (= W321)
4h4uA Crystal structure of ferredoxin reductase, bpha4 t176r mutant (reduced form)
35% identity, 89% coverage: 7:333/369 of query aligns to 6:328/401 of 4h4uA
- active site: L13 (≠ A14), R44 (= R45), P45 (= P46), Q291 (≠ S297)
- binding flavin-adenine dinucleotide: G12 (≠ S13), A14 (= A15), D36 (≠ K37), R44 (= R45), P45 (= P46), A78 (= A83), T105 (= T110), G106 (= G111), L125 (= L129), R126 (= R130), I152 (= I156), E155 (= E159), G268 (= G274), D269 (= D275), E285 (= E291), T286 (≠ H292), W287 (≠ R293), A290 (= A296), W316 (= W321)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V151 (≠ F155), I152 (= I156), E171 (≠ D175), R172 (≠ K176), Q173 (≠ S177), G230 (≠ A239), I231 (= I240), G232 (= G241), I284 (= I290), E285 (= E291), Y315 (≠ F320)
2gr2A Crystal structure of ferredoxin reductase, bpha4 (oxidized form)
35% identity, 89% coverage: 7:333/369 of query aligns to 5:327/401 of 2gr2A
- active site: L12 (≠ A14), R43 (= R45), P44 (= P46), Q290 (≠ S297)
- binding adenosine-5-diphosphoribose: R109 (= R115), V146 (= V151), G147 (= G152), G149 (= G154), V150 (≠ F155), I151 (= I156), E170 (≠ D175), T171 (≠ K176), R178 (≠ A183), G229 (≠ A239), I230 (= I240), G231 (= G241), E284 (= E291)
- binding flavin-adenine dinucleotide: G11 (≠ S13), A13 (= A15), D35 (≠ K37), E36 (= E38), R43 (= R45), P44 (= P46), K48 (= K50), A77 (= A83), T104 (= T110), G105 (= G111), R125 (= R130), G267 (= G274), D268 (= D275), T285 (≠ H292), W286 (≠ R293), A289 (= A296), W315 (= W321)
2gr0A Crystal structure of ferredoxin reductase, bpha4 (oxidized form, NAD+ complex) (see paper)
35% identity, 89% coverage: 7:333/369 of query aligns to 5:327/401 of 2gr0A
- active site: L12 (≠ A14), R43 (= R45), P44 (= P46), Q290 (≠ S297)
- binding adenosine-5'-diphosphate: V146 (= V151), G147 (= G152), G149 (= G154), I151 (= I156), E170 (≠ D175), T171 (≠ K176), R178 (≠ A183), G229 (≠ A239), I230 (= I240), G231 (= G241)
- binding flavin-adenine dinucleotide: G11 (≠ S13), A13 (= A15), D35 (≠ K37), E36 (= E38), R43 (= R45), P44 (= P46), K48 (= K50), T76 (≠ S82), A77 (= A83), T104 (= T110), G105 (= G111), R125 (= R130), I151 (= I156), G267 (= G274), D268 (= D275), E284 (= E291), T285 (≠ H292), W286 (≠ R293), A289 (= A296), W315 (= W321)
1f3pA Ferredoxin reductase (bpha4)-nadh complex (see paper)
35% identity, 89% coverage: 7:333/369 of query aligns to 6:328/401 of 1f3pA
- active site: L13 (≠ A14), R44 (= R45), P45 (= P46), Q291 (≠ S297)
- binding flavin-adenine dinucleotide: A14 (= A15), V34 (≠ I35), D36 (≠ K37), E37 (= E38), R44 (= R45), P45 (= P46), A78 (= A83), T105 (= T110), G106 (= G111), R126 (= R130), G268 (= G274), D269 (= D275), E285 (= E291), T286 (≠ H292), W287 (≠ R293), A290 (= A296), W316 (= W321)
- binding nicotinamide-adenine-dinucleotide: V147 (= V151), G148 (= G152), G150 (= G154), V151 (≠ F155), I152 (= I156), E155 (= E159), E171 (≠ D175), T172 (≠ K176), R179 (≠ A183), G230 (≠ A239), I231 (= I240), G232 (= G241), V233 (≠ A242), E285 (= E291), W316 (= W321), S317 (= S322)
2yvjA Crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex (see paper)
35% identity, 89% coverage: 7:333/369 of query aligns to 6:328/402 of 2yvjA
- active site: L13 (≠ A14), R44 (= R45), P45 (= P46), Q291 (≠ S297)
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (≠ S13), G35 (= G36), D36 (≠ K37), E37 (= E38), R44 (= R45), P45 (= P46), A78 (= A83), T105 (= T110), G106 (= G111), R126 (= R130), G268 (= G274), D269 (= D275), T286 (≠ H292), W287 (≠ R293), A290 (= A296), W316 (= W321)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V147 (= V151), G148 (= G152), G149 (≠ A153), G150 (= G154), I152 (= I156), V170 (≠ I174), E171 (≠ D175), T172 (≠ K176), R179 (≠ A183), G230 (≠ A239), I231 (= I240), G232 (= G241), V233 (≠ A242), E285 (= E291)
8pxkA Structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a (see paper)
35% identity, 89% coverage: 7:333/369 of query aligns to 7:329/403 of 8pxkA
- binding flavin-adenine dinucleotide: G13 (≠ S13), A15 (= A15), D37 (≠ K37), E38 (= E38), R45 (= R45), P46 (= P46), K50 (= K50), A79 (= A83), T106 (= T110), G107 (= G111), R127 (= R130), I153 (= I156), G269 (= G274), D270 (= D275), E286 (= E291), T287 (≠ H292), W288 (≠ R293), A291 (= A296), W317 (= W321)
4h4wA Crystal structure of ferredoxin reductase, bpha4 e175c/t176r/q177g mutant (reduced form)
35% identity, 89% coverage: 7:333/369 of query aligns to 5:327/399 of 4h4wA
- active site: L12 (≠ A14), R43 (= R45), P44 (= P46), Q290 (≠ S297)
- binding flavin-adenine dinucleotide: G11 (≠ S13), A13 (= A15), D35 (≠ K37), R43 (= R45), P44 (= P46), A77 (= A83), T104 (= T110), G105 (= G111), R125 (= R130), I151 (= I156), E154 (= E159), G267 (= G274), D268 (= D275), T285 (≠ H292), W286 (≠ R293), A289 (= A296), W315 (= W321)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G148 (≠ A153), I151 (= I156), R171 (≠ K176), S177 (≠ G182), R178 (≠ A183), G229 (≠ A239), I230 (= I240), G231 (= G241)
3lxdA Crystal structure of ferredoxin reductase arr from novosphingobium aromaticivorans (see paper)
33% identity, 89% coverage: 7:333/369 of query aligns to 6:338/409 of 3lxdA
- active site: H13 (≠ A14), R44 (= R45), P45 (= P46), N302 (≠ S297)
- binding flavin-adenine dinucleotide: V9 (= V10), G10 (= G11), G12 (≠ S13), H13 (≠ A14), G14 (≠ A15), R36 (≠ K37), E37 (= E38), R44 (= R45), P45 (= P46), S48 (= S49), K49 (= K50), E81 (≠ S82), V82 (≠ A83), T109 (= T110), I157 (= I156), G278 (= G274), D279 (= D275), S297 (≠ H292), V298 (≠ R293), F325 (= F320), W326 (= W321)
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
30% identity, 87% coverage: 5:324/369 of query aligns to 2:324/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G11), G10 (≠ S13), H11 (≠ A14), A12 (= A15), D34 (≠ K37), E35 (= E38), R42 (= R45), P43 (= P46), S46 (= S49), K47 (= K50), R78 (≠ T81), M79 (≠ S82), T106 (= T110), R127 (= R130), I153 (= I156), D275 (= D275), S292 (≠ H292), V293 (≠ R293), W321 (= W321)
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
32% identity, 90% coverage: 6:337/369 of query aligns to 4:337/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (≠ S13), V12 (≠ A14), G13 (≠ A15), D35 (≠ K37), E36 (= E38), R43 (= R45), P44 (= P46), S47 (= S49), K48 (= K50), V80 (≠ A83), T107 (= T110), G108 (= G111), R128 (= R130), G274 (= G274), D275 (= D275), T291 (≠ H292), Y292 (≠ R293), S319 (≠ F320), W320 (= W321)
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
32% identity, 90% coverage: 6:337/369 of query aligns to 3:336/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (≠ S13), V11 (≠ A14), G12 (≠ A15), D34 (≠ K37), E35 (= E38), R42 (= R45), P43 (= P46), K47 (= K50), E78 (≠ S82), V79 (≠ A83), T106 (= T110), G107 (= G111), G273 (= G274), D274 (= D275), T290 (≠ H292), Y291 (≠ R293), W319 (= W321)
- binding nicotinamide-adenine-dinucleotide: R111 (= R115), G149 (= G152), L152 (≠ F155), I153 (= I156), E156 (= E159), E172 (≠ D175), A173 (≠ K176), R180 (≠ V179), V236 (≠ I240), G237 (= G241), A238 (= A242), E289 (= E291), W319 (= W321), T320 (≠ S322)
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
30% identity, 82% coverage: 8:309/369 of query aligns to 4:310/424 of 8c0zE
Q9LK94 Monodehydroascorbate reductase 4, peroxisomal; AtMDAR4; EC 1.6.5.4 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 82% coverage: 30:333/369 of query aligns to 31:356/488 of Q9LK94
Sites not aligning to the query:
- 11 G→Q: In sdp2-2; loss of ascorbate recycling.
- 14 V→A: In sdp2-1; loss of ascorbate recycling.
- 386 G→Q: In sdp2-3; loss of ascorbate recycling.
- 483:488 mutation Missing: Loss of peroxisomal targeting.
- 488 mutation Missing: No effect on peroxisomal targeting.
Q9Z0X1 Apoptosis-inducing factor 1, mitochondrial; Programmed cell death protein 8; EC 1.6.99.- from Mus musculus (Mouse) (see 4 papers)
26% identity, 88% coverage: 1:323/369 of query aligns to 125:484/612 of Q9Z0X1
- GGGTA 137:141 (≠ GASAA 11:15) binding
- ED 163:164 (≠ KE 37:38) binding
- R171 (= R45) binding
- K176 (= K50) binding ; mutation to A: Increases catalytic efficiency.
- W195 (≠ E67) mutation to A: Increases redox potential, reacts faster to NADH and forms two-fold longer-lived CTC.
- V232 (≠ A83) binding
- K254 (≠ R105) mutation to A: Abolished DNA-binding without affecting binding to poly-ADP-ribose chains; when associated with A-264.
- R264 (= R115) mutation to A: Abolished DNA-binding without affecting binding to poly-ADP-ribose chains; when associated with A-254.
- R284 (= R130) binding
- GGFL 307:310 (≠ AGFI 153:156) binding
- E313 (= E159) mutation to A: Increases catalytic efficiency 30-fold. Increases affinity for NADH 20-fold.
- E335 (≠ S177) binding
- K341 (≠ A183) binding
- G398 (= G241) binding
- D437 (= D275) binding
- EH 452:453 (= EH 291:292) binding
- HH 453:454 (≠ HR 292:293) binding
- W482 (= W321) binding ; binding
Sites not aligning to the query:
- 55:101 modified: propeptide, Removed in mature form
- 588:592 RKIIK→AAIIA: Abolished binding to poly-ADP-ribose chains, preventing induction of parthanatos.
8d3jA Crystal structure of human apoptosis-inducing factor (aif) complexed with 6-fluoro-2-methylquinolin-4-amine
26% identity, 87% coverage: 2:323/369 of query aligns to 1:356/436 of 8d3jA
- binding flavin-adenine dinucleotide: G12 (= G11), A16 (= A15), E38 (≠ K37), D39 (≠ E38), R46 (= R45), P47 (= P46), K51 (= K50), K103 (≠ S82), V104 (≠ A83), T131 (= T110), F155 (≠ L129), R156 (= R130), G308 (= G274), D309 (= D275), E324 (= E291), H325 (= H292), H326 (≠ R293), W354 (= W321)
- binding 6-fluoro-2-methylquinolin-4-amine: F181 (= F155), L182 (≠ I156), E185 (= E159), H325 (= H292), F353 (= F320), W354 (= W321), S355 (= S322)
8d3iA Crystal structure of human apoptosis-inducing factor (aif) w196a mutant complexed with quinolin-4-amine
26% identity, 87% coverage: 2:323/369 of query aligns to 1:359/439 of 8d3iA
- binding quinolin-4-amine: F184 (= F155), L185 (≠ I156), E188 (= E159), W357 (= W321)
- binding flavin-adenine dinucleotide: G12 (= G11), A16 (= A15), E38 (≠ K37), D39 (≠ E38), R46 (= R45), P47 (= P46), K51 (= K50), K106 (≠ S82), V107 (≠ A83), T134 (= T110), F158 (≠ L129), G311 (= G274), D312 (= D275), E327 (= E291), H328 (= H292), H329 (≠ R293), W357 (= W321)
1gv4A Murine apoptosis-inducing factor (aif) (see paper)
26% identity, 88% coverage: 1:323/369 of query aligns to 5:364/490 of 1gv4A
- active site: L198 (vs. gap)
- binding flavin-adenine dinucleotide: G17 (= G11), G19 (≠ S13), T20 (≠ A14), A21 (= A15), E43 (≠ K37), D44 (≠ E38), R51 (= R45), P52 (= P46), K56 (= K50), K111 (≠ S82), V112 (≠ A83), T139 (= T110), G140 (= G111), F163 (≠ L129), R164 (= R130), G316 (= G274), D317 (= D275), E332 (= E291), H333 (= H292), H334 (≠ R293), F361 (= F320), W362 (= W321)
Sites not aligning to the query:
Query Sequence
>RR42_RS29850 FitnessBrowser__Cup4G11:RR42_RS29850
MNSPEHIVVVGASAAGITAARALRAQGWGGRLTLIGKEGGMPYDRPPLSKRLMAGECPVE
ALNLVSEDGMKALNLHYLDGTSATGLDTDASSLQLSNGSTLQYDRLLIATGADARVIPNL
SQAANCYSLRNLNDALAIREHLTAGKRVLVVGAGFIGTELAAIAKTSGCEVTVIDKSKVP
LGARVGDIVGKRIEKLHEANGVVFHNDCELREVKWRDRTITEVRLDTGVVIACDVIVVAI
GAVPSVQWCSGLNIRSGVVCNEYCEAAPNVYAAGDAAEWFHKGYGEHMRIEHRTNASEQA
MAAAKNMLGSRVEYAPLPFFWSDQYQVQIHSYGRIGPQYTVEVVEGDQLKDDSCIFRYYQ
GDVLMGVLS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory