SitesBLAST
Comparing RR42_RS29880 FitnessBrowser__Cup4G11:RR42_RS29880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 37% coverage: 50:182/357 of query aligns to 98:228/467 of 7qh2C
- binding flavin-adenine dinucleotide: P137 (≠ R91), G138 (≠ F92), E139 (≠ A93), A142 (≠ S96), T143 (= T97), G146 (= G100), N147 (≠ A101), S149 (≠ A103), T150 (≠ A104), A152 (≠ L106), G153 (≠ S107), E203 (≠ M157), G204 (= G158), I209 (= I163)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 73, 75, 76, 77, 78, 79, 80, 83, 84, 422, 423
- binding fe (iii) ion: 377, 384, 422
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
27% identity, 50% coverage: 5:182/357 of query aligns to 47:225/465 of 3pm9A
- active site: A149 (≠ L106), L159 (≠ S116)
- binding flavin-adenine dinucleotide: P69 (≠ I27), Q70 (≠ V28), G71 (= G29), G72 (= G30), N73 (≠ G31), T74 (= T32), G75 (≠ K33), L76 (≠ C34), G79 (= G37), Q80 (≠ E38), L91 (≠ V47), L133 (≠ R91), G134 (≠ F92), A135 (= A93), C139 (vs. gap), T140 (= T97), G142 (= G99), G143 (= G100), S146 (≠ A103), T147 (≠ A104), A149 (≠ L106), G150 (≠ S107), E200 (≠ M157), G201 (= G158), I205 (≠ V162), I206 (= I163)
Sites not aligning to the query:
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
30% identity, 46% coverage: 7:172/357 of query aligns to 111:274/521 of Q8N465
- N127 (= N26) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G30) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (vs. gap) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ L50) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ T69) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A86) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A103) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ G129) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G131) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 109 S → W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 375 D → Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- 386 binding ; binding ; binding ; R→A: Loss of catalytic activity.
- 390 binding ; binding ; T→A: Significantly reduced catalytic activity.
- 399 V → M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- 401 binding ; binding ; K→A: Loss of catalytic activity.
- 419 R → H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- 426 A → T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- 434 binding ; H→A: Loss of catalytic activity.
- 436 G → V: slight reduction in catalytic activity
- 439 N → D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- 441 binding ; H→A: Loss of catalytic activity.
- 443 binding ; N→A: Significantly reduced catalytic activity.
- 444 V → A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- 446 A → V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- 475 binding ; E→A: Loss of catalytic activity.
- 476 binding ; binding ; binding ; H→A: Loss of catalytic activity.
- 477 G → R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
O00116 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Aging-associated gene 5 protein; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Homo sapiens (Human) (see 2 papers)
29% identity, 47% coverage: 5:173/357 of query aligns to 212:384/658 of O00116
Sites not aligning to the query:
- 182 R → Q: in RCDP3; severely reduced protein levels
- 419 Important for enzyme activity; R → H: in RCDP3; loss of enzyme activity; dbSNP:rs121434411
- 471 E → K: in RCDP3; severely reduced protein levels
- 568 T → M: in RCDP3; does not affect protein levels; dbSNP:rs387907214
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
30% identity, 46% coverage: 7:172/357 of query aligns to 59:222/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (≠ I27), G78 (= G29), G79 (= G30), N80 (≠ G31), T81 (= T32), G82 (≠ K33), M83 (≠ C34), G86 (= G37), S87 (≠ E38), L140 (≠ R91), A142 (= A93), C146 (≠ T97), H147 (vs. gap), G150 (= G100), N151 (≠ A101), A153 (= A103), T154 (≠ A104), G208 (= G158), I212 (≠ V162), I213 (= I163)
Sites not aligning to the query:
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
30% identity, 46% coverage: 7:172/357 of query aligns to 58:221/466 of 6lpxA
- binding flavin-adenine dinucleotide: P75 (≠ I27), Q76 (≠ V28), G77 (= G29), G78 (= G30), N79 (≠ G31), T80 (= T32), G81 (≠ K33), M82 (≠ C34), G85 (= G37), S86 (≠ E38), L139 (≠ R91), G140 (≠ F92), A141 (= A93), C145 (≠ T97), G149 (= G100), N150 (≠ A101), A152 (= A103), T153 (≠ A104), G157 (= G108), G207 (= G158), I212 (= I163)
Sites not aligning to the query:
- binding 2-oxoglutaric acid: 333, 337, 348, 379, 381, 388, 423
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding zinc ion: 381, 388, 422
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
30% identity, 46% coverage: 7:172/357 of query aligns to 58:221/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (≠ I27), G77 (= G29), G78 (= G30), N79 (≠ G31), T80 (= T32), G81 (≠ K33), G85 (= G37), S86 (≠ E38), L139 (≠ R91), G140 (≠ F92), A141 (= A93), C145 (≠ T97), H146 (vs. gap), G148 (= G99), G149 (= G100), N150 (≠ A101), A152 (= A103), T153 (≠ A104), A155 (≠ L106), E206 (≠ M157), G207 (= G158), I211 (≠ V162), I212 (= I163)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding (2s)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 423
- binding zinc ion: 381, 388, 422
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
30% identity, 46% coverage: 7:172/357 of query aligns to 58:221/466 of 6lpqA
- binding flavin-adenine dinucleotide: P75 (≠ I27), G77 (= G29), G78 (= G30), N79 (≠ G31), T80 (= T32), G81 (≠ K33), G85 (= G37), S86 (≠ E38), L139 (≠ R91), G140 (≠ F92), A141 (= A93), C145 (≠ T97), H146 (vs. gap), G149 (= G100), N150 (≠ A101), A152 (= A103), T153 (≠ A104), A155 (≠ L106), G157 (= G108), E206 (≠ M157), G207 (= G158), I211 (≠ V162), I212 (= I163)
- binding d-malate: M82 (≠ C34)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding d-malate: 333, 337, 348, 379, 381, 388, 422, 423
- binding zinc ion: 381, 388, 422
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
30% identity, 46% coverage: 7:172/357 of query aligns to 58:221/466 of 6lppA
- binding flavin-adenine dinucleotide: P75 (≠ I27), G77 (= G29), G78 (= G30), N79 (≠ G31), T80 (= T32), G81 (≠ K33), M82 (≠ C34), G85 (= G37), S86 (≠ E38), L139 (≠ R91), G140 (≠ F92), A141 (= A93), C145 (≠ T97), G149 (= G100), N150 (≠ A101), A152 (= A103), T153 (≠ A104), A155 (≠ L106), G157 (= G108), G207 (= G158), I212 (= I163)
Sites not aligning to the query:
- binding (2R)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 390, 423
- binding flavin-adenine dinucleotide: 39, 422, 423
- binding zinc ion: 381, 388, 422
5ae3A Ether lipid-generating enzyme agps in complex with antimycin a (see paper)
28% identity, 47% coverage: 5:172/357 of query aligns to 118:289/539 of 5ae3A
- binding flavin-adenine dinucleotide: P140 (≠ I27), I141 (≠ V28), G142 (= G29), G143 (= G30), G144 (= G31), T145 (= T32), S146 (≠ K33), V147 (≠ C34), L151 (vs. gap), P208 (= P89), D209 (≠ P90), S210 (≠ R91), S214 (= S96), T215 (= T97), G218 (= G100), W219 (≠ A101), S221 (≠ A103), T222 (≠ A104), A224 (≠ L106), S225 (= S107), E274 (≠ M157), V279 (= V162), I280 (= I163)
Sites not aligning to the query:
- binding [(2R,3S,6S,7R,8R)-3-[(3-formamido-2-oxidanyl-phenyl)carbonylamino]-8-hexyl-2,6-dimethyl-4,9-bis(oxidanylidene)-1,5-dioxonan-7-yl] 3-methylbutanoate: 45, 49, 53, 325, 327, 331, 334, 349, 386, 393, 396, 400, 447, 461
- binding flavin-adenine dinucleotide: 497
6gouA Development of alkyl glycerone phosphate synthase inhibitors: complex with inhibitor 2i (see paper)
28% identity, 47% coverage: 5:172/357 of query aligns to 132:303/554 of 6gouA
- binding (3~{S})-3-[2,6-bis(fluoranyl)phenyl]-~{N}-[(2-oxidanylidene-1,3-dihydrobenzimidazol-5-yl)methyl]butanamide: D223 (≠ P90)
- binding flavin-adenine dinucleotide: P154 (≠ I27), I155 (≠ V28), G156 (= G29), G157 (= G30), G158 (= G31), T159 (= T32), S160 (≠ K33), V161 (≠ C34), G164 (= G37), P222 (= P89), D223 (≠ P90), S224 (≠ R91), S228 (= S96), T229 (= T97), G232 (= G100), W233 (≠ A101), S235 (≠ A103), T236 (≠ A104), A238 (≠ L106), S239 (= S107), E288 (≠ M157), V293 (= V162), I294 (= I163)
Sites not aligning to the query:
5ae2A Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
28% identity, 47% coverage: 5:172/357 of query aligns to 123:294/561 of 5ae2A
- binding flavin-adenine dinucleotide: P145 (≠ I27), I146 (≠ V28), G147 (= G29), G148 (= G30), G149 (= G31), T150 (= T32), S151 (≠ K33), G155 (= G37), L156 (vs. gap), P213 (= P89), D214 (≠ P90), S215 (≠ R91), S219 (= S96), T220 (= T97), G223 (= G100), W224 (≠ A101), S226 (≠ A103), T227 (≠ A104), A229 (≠ L106), S230 (= S107), E279 (≠ M157), V284 (= V162), I285 (= I163)
Sites not aligning to the query:
5adzC Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
28% identity, 47% coverage: 5:172/357 of query aligns to 132:303/557 of 5adzC
- binding flavin-adenine dinucleotide: P154 (≠ I27), I155 (≠ V28), G156 (= G29), G157 (= G30), G158 (= G31), T159 (= T32), S160 (≠ K33), P222 (= P89), D223 (≠ P90), S224 (≠ R91), S228 (= S96), T229 (= T97), G232 (= G100), W233 (≠ A101), S235 (≠ A103), T236 (≠ A104), A238 (≠ L106), S239 (= S107), E288 (≠ M157), G289 (= G158), I294 (= I163)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D223 (≠ P90)
Sites not aligning to the query:
P97275 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Cavia porcellus (Guinea pig) (see 4 papers)
28% identity, 47% coverage: 5:172/357 of query aligns to 212:383/658 of P97275
- 234:240 (vs. 27:33, 57% identical) binding
- H300 (≠ F87) mutation to A: Loss of activity.
- 303:309 (vs. 90:97, 25% identical) binding
- T309 (= T97) mutation to I: Impaired FAD binding and protein stability. Loss of activity.
- TRAS 316:319 (≠ AGLS 104:107) binding
- S367 (= S156) mutation to A: Strongly reduced activity.
- 368:374 (vs. 157:163, 71% identical) binding
Sites not aligning to the query:
- 1:58 modified: transit peptide, Peroxisome
- 419 Important for enzyme activity; R→H: Loss of activity.; R→K: Strongly reduced activity.
- 469 L→P: Impaired FAD binding and protein stability. Loss of activity.
- 515 binding ; R→L: Impaired FAD binding and protein stability. Loss of activity.
- 576 C→A: No effect on activity.
- 578 active site, Proton donor/acceptor; Y→F: Loss of activity.
- 615 H→A: Loss of activity.
- 615:617 Important for enzyme activity
- 616 H→A: Loss of activity.
- 617 H→A: Loss of activity.
- 654:658 Important for enzyme activity
4bc9A Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
28% identity, 47% coverage: 5:172/357 of query aligns to 123:294/555 of 4bc9A
- binding propanenitrile: D214 (≠ P90)
- binding flavin-adenine dinucleotide: P145 (≠ I27), I146 (≠ V28), G147 (= G29), G148 (= G30), G149 (= G31), T150 (= T32), S151 (≠ K33), V152 (≠ C34), G155 (= G37), L156 (vs. gap), P213 (= P89), D214 (≠ P90), S215 (≠ R91), S219 (= S96), T220 (= T97), G223 (= G100), W224 (≠ A101), S226 (≠ A103), T227 (≠ A104), A229 (≠ L106), S230 (= S107), E279 (≠ M157), V284 (= V162), I285 (= I163)
Sites not aligning to the query:
5ae1B Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
28% identity, 47% coverage: 5:172/357 of query aligns to 118:289/539 of 5ae1B
- binding flavin-adenine dinucleotide: P140 (≠ I27), I141 (≠ V28), G142 (= G29), G143 (= G30), G144 (= G31), T145 (= T32), S146 (≠ K33), G150 (= G37), L151 (vs. gap), P208 (= P89), D209 (≠ P90), S210 (≠ R91), S214 (= S96), T215 (= T97), G218 (= G100), W219 (≠ A101), S221 (≠ A103), T222 (≠ A104), A224 (≠ L106), S225 (= S107), E274 (≠ M157), V279 (= V162), I280 (= I163)
Sites not aligning to the query:
4bc9B Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
28% identity, 47% coverage: 5:172/357 of query aligns to 118:289/542 of 4bc9B
- binding propanenitrile: D209 (≠ P90)
- binding flavin-adenine dinucleotide: P140 (≠ I27), G142 (= G29), G143 (= G30), G144 (= G31), T145 (= T32), S146 (≠ K33), V147 (≠ C34), G150 (= G37), L151 (vs. gap), P208 (= P89), D209 (≠ P90), S210 (≠ R91), S214 (= S96), T215 (= T97), G218 (= G100), W219 (≠ A101), S221 (≠ A103), T222 (≠ A104), A224 (≠ L106), S225 (= S107), E274 (≠ M157), G275 (= G158), I280 (= I163)
Sites not aligning to the query:
4bc7B Mammalian alkyldihydroxyacetonephosphate synthase: arg419his mutant (see paper)
28% identity, 47% coverage: 5:172/357 of query aligns to 118:289/543 of 4bc7B
- binding flavin-adenine dinucleotide: P140 (≠ I27), G142 (= G29), G143 (= G30), G144 (= G31), T145 (= T32), S146 (≠ K33), V147 (≠ C34), G150 (= G37), L151 (vs. gap), P208 (= P89), D209 (≠ P90), S210 (≠ R91), S214 (= S96), T215 (= T97), G218 (= G100), S221 (≠ A103), T222 (≠ A104), A224 (≠ L106), S225 (= S107), E274 (≠ M157), G275 (= G158), I280 (= I163)
Sites not aligning to the query:
5ae2B Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
28% identity, 47% coverage: 5:172/357 of query aligns to 118:289/542 of 5ae2B
- binding flavin-adenine dinucleotide: P140 (≠ I27), G142 (= G29), G143 (= G30), G144 (= G31), T145 (= T32), S146 (≠ K33), G150 (= G37), L151 (vs. gap), P208 (= P89), D209 (≠ P90), S210 (≠ R91), S214 (= S96), T215 (= T97), G218 (= G100), W219 (≠ A101), S221 (≠ A103), T222 (≠ A104), A224 (≠ L106), S225 (= S107), E274 (≠ M157), G275 (= G158), V279 (= V162), I280 (= I163)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 500
- binding 3-(2-fluorophenyl)-2-methyl-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)acrylamide: 399, 409, 410, 411, 462, 464, 466, 500, 501
5adzA Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
28% identity, 47% coverage: 5:172/357 of query aligns to 120:291/566 of 5adzA
- binding flavin-adenine dinucleotide: P142 (≠ I27), I143 (≠ V28), G144 (= G29), G145 (= G30), G146 (= G31), T147 (= T32), S148 (≠ K33), G152 (= G37), P210 (= P89), D211 (≠ P90), S212 (≠ R91), S216 (= S96), T217 (= T97), G220 (= G100), W221 (≠ A101), S223 (≠ A103), T224 (≠ A104), A226 (≠ L106), S227 (= S107), E276 (≠ M157), G277 (= G158), V281 (= V162), I282 (= I163)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D211 (≠ P90)
Sites not aligning to the query:
Query Sequence
>RR42_RS29880 FitnessBrowser__Cup4G11:RR42_RS29880
MTTIPTEVSHLIETVLHARKTKTSLNIVGGGTKCFYGEEPSGEPCDVRRLSGICSYEPSE
LVVTARAGTPLEELEAVLAEHNQYLAFEPPRFAKGSTVGGAVAAGLSGPARVGVGSIRDF
VLGATMINGKGELLTFGGQVMKNVAGYDVSRLLAGSMGILGVICEVSLKVLPIHSSRITL
FIERDEAGALSLLNGLTRQALPVNASAWHDGKLFLRLSGAASAVTEARKRLGGTELEPDE
ALSWWDAVRDHRHDFFSQSDAPLWRVSVPAVSQPFLAANQLIEWGGALRWLYTDDPIEDV
REMASSLGGHATLFRDPHHRSGVFTPPSDALFEIHRNLKQAFDPDGIFNVGRLYPGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory