SitesBLAST
Comparing RR42_RS29885 FitnessBrowser__Cup4G11:RR42_RS29885 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
30% identity, 89% coverage: 26:475/503 of query aligns to 11:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ A88), G75 (= G90), S76 (≠ A91), G77 (= G92), T78 (= T93), G79 (= G94), L80 (= L95), A83 (≠ G98), C84 (≠ A99), P137 (= P152), G138 (≠ S153), E139 (≠ S154), A142 (= A157), T143 (= T159), G146 (= G162), N147 (= N163), S149 (≠ A165), T150 (≠ E166), A152 (≠ S168), G153 (= G169), E203 (= E218), G204 (= G219), I209 (≠ T224), E422 (= E434), H423 (= H435)
- binding fe (iii) ion: H377 (= H390), H384 (= H397), E422 (= E434)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 84% coverage: 53:476/503 of query aligns to 33:456/459 of P9WIT1
- K354 (≠ A369) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
28% identity, 84% coverage: 54:476/503 of query aligns to 33:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L95), R317 (= R341), W321 (≠ F345), H368 (= H390), H375 (= H397), H413 (= H435)
- binding flavin-adenine dinucleotide: P68 (≠ A88), G70 (= G90), T71 (≠ A91), G72 (= G92), T73 (= T93), G74 (= G94), G78 (= G98), V79 (≠ A99), L90 (= L110), P132 (= P152), G133 (≠ S153), A134 (≠ S154), G140 (= G162), M141 (≠ N163), A143 (= A165), T144 (≠ E166), A146 (≠ S168), S147 (≠ G169), E200 (= E218), G201 (= G219), I206 (≠ T224), W321 (≠ F345), Y322 (≠ P346), E412 (= E434), H413 (= H435), N449 (= N471)
- binding manganese (ii) ion: H368 (= H390), H375 (= H397), E412 (= E434)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
28% identity, 84% coverage: 54:476/503 of query aligns to 33:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R341), H369 (= H390), H376 (= H397), H414 (= H435)
- binding flavin-adenine dinucleotide: P68 (≠ A88), G70 (= G90), T71 (≠ A91), G72 (= G92), T73 (= T93), G74 (= G94), G78 (= G98), V79 (≠ A99), L90 (= L110), P132 (= P152), G133 (≠ S153), A134 (≠ S154), G140 (= G162), M141 (≠ N163), A143 (= A165), T144 (≠ E166), A146 (≠ S168), S147 (≠ G169), E200 (= E218), G201 (= G219), I206 (≠ T224), W322 (≠ F345), E413 (= E434), H414 (= H435), N450 (= N471)
- binding manganese (ii) ion: H369 (= H390), H376 (= H397), E413 (= E434)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
28% identity, 84% coverage: 54:476/503 of query aligns to 33:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: P68 (≠ A88), G70 (= G90), T71 (≠ A91), G72 (= G92), T73 (= T93), G74 (= G94), G78 (= G98), V79 (≠ A99), L90 (= L110), P132 (= P152), G133 (≠ S153), A134 (≠ S154), G140 (= G162), M141 (≠ N163), A143 (= A165), T144 (≠ E166), A146 (≠ S168), S147 (≠ G169), E200 (= E218), G201 (= G219), I206 (≠ T224), W323 (≠ F345), E414 (= E434), H415 (= H435), N451 (= N471)
- binding manganese (ii) ion: H370 (= H390), H377 (= H397), E414 (= E434)
- binding pyruvic acid: R319 (= R341), H370 (= H390), H377 (= H397), H415 (= H435)
Sites not aligning to the query:
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
28% identity, 84% coverage: 54:476/503 of query aligns to 33:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (≠ A88), G70 (= G90), T71 (≠ A91), G72 (= G92), T73 (= T93), G74 (= G94), G78 (= G98), V79 (≠ A99), L90 (= L110), P132 (= P152), G133 (≠ S153), A134 (≠ S154), G140 (= G162), M141 (≠ N163), A143 (= A165), T144 (≠ E166), A146 (≠ S168), S147 (≠ G169), E200 (= E218), G201 (= G219), I206 (≠ T224), W322 (≠ F345), E413 (= E434), H414 (= H435), N450 (= N471)
- binding lactic acid: R318 (= R341), H369 (= H390), H376 (= H397), H414 (= H435)
- binding manganese (ii) ion: H369 (= H390), H376 (= H397), E413 (= E434)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
28% identity, 84% coverage: 54:476/503 of query aligns to 33:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R341), W322 (≠ F345), H369 (= H390), H376 (= H397), H414 (= H435)
- binding flavin-adenine dinucleotide: P68 (≠ A88), G70 (= G90), T71 (≠ A91), G72 (= G92), T73 (= T93), G74 (= G94), G78 (= G98), V79 (≠ A99), L90 (= L110), P132 (= P152), G133 (≠ S153), A134 (≠ S154), G140 (= G162), M141 (≠ N163), A143 (= A165), T144 (≠ E166), A146 (≠ S168), S147 (≠ G169), E200 (= E218), G201 (= G219), I206 (≠ T224), W322 (≠ F345), E413 (= E434), N450 (= N471)
- binding manganese (ii) ion: H369 (= H390), H376 (= H397), E413 (= E434)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
28% identity, 84% coverage: 54:476/503 of query aligns to 33:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (≠ A88), G70 (= G90), T71 (≠ A91), G72 (= G92), T73 (= T93), G74 (= G94), G78 (= G98), V79 (≠ A99), L90 (= L110), P132 (= P152), G133 (≠ S153), A134 (≠ S154), G140 (= G162), M141 (≠ N163), A143 (= A165), T144 (≠ E166), A146 (≠ S168), S147 (≠ G169), E200 (= E218), G201 (= G219), I206 (≠ T224), H369 (= H390), E413 (= E434), N450 (= N471)
- binding deaminohydroxyvaline: R319 (= R341), H414 (= H435)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
28% identity, 84% coverage: 54:476/503 of query aligns to 33:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: P68 (≠ A88), G70 (= G90), T71 (≠ A91), G72 (= G92), T73 (= T93), G74 (= G94), G78 (= G98), V79 (≠ A99), L90 (= L110), P132 (= P152), G133 (≠ S153), A134 (≠ S154), G140 (= G162), M141 (≠ N163), A143 (= A165), T144 (≠ E166), A146 (≠ S168), S147 (≠ G169), E200 (= E218), G201 (= G219), I206 (≠ T224), W322 (≠ F345), E413 (= E434), H414 (= H435), N450 (= N471)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R341), H369 (= H390), H376 (= H397), H414 (= H435)
- binding manganese (ii) ion: H369 (= H390), H376 (= H397), E413 (= E434)
Sites not aligning to the query:
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
28% identity, 84% coverage: 54:476/503 of query aligns to 33:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (≠ A88), G70 (= G90), T71 (≠ A91), G72 (= G92), T73 (= T93), G74 (= G94), G78 (= G98), V79 (≠ A99), L90 (= L110), P132 (= P152), G133 (≠ S153), A134 (≠ S154), G140 (= G162), M141 (≠ N163), A143 (= A165), T144 (≠ E166), A146 (≠ S168), S147 (≠ G169), E200 (= E218), G201 (= G219), I206 (≠ T224), Y324 (≠ P346), H370 (= H390), E414 (= E434), N451 (= N471)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R341), W323 (≠ F345), H415 (= H435)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
28% identity, 84% coverage: 54:476/503 of query aligns to 33:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R341), W323 (≠ F345), H370 (= H390), H415 (= H435)
- binding flavin-adenine dinucleotide: P68 (≠ A88), G70 (= G90), T71 (≠ A91), G72 (= G92), T73 (= T93), G74 (= G94), G78 (= G98), V79 (≠ A99), L90 (= L110), P132 (= P152), G133 (≠ S153), A134 (≠ S154), G140 (= G162), M141 (≠ N163), A143 (= A165), T144 (≠ E166), A146 (≠ S168), S147 (≠ G169), E200 (= E218), G201 (= G219), I206 (≠ T224), H370 (= H390), E414 (= E434), N451 (= N471)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
28% identity, 84% coverage: 54:476/503 of query aligns to 33:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R341), W323 (≠ F345), H415 (= H435)
- binding flavin-adenine dinucleotide: P68 (≠ A88), G70 (= G90), T71 (≠ A91), G72 (= G92), T73 (= T93), G74 (= G94), G78 (= G98), V79 (≠ A99), L90 (= L110), P132 (= P152), G133 (≠ S153), A134 (≠ S154), G140 (= G162), M141 (≠ N163), A143 (= A165), T144 (≠ E166), A146 (≠ S168), S147 (≠ G169), E200 (= E218), G201 (= G219), I206 (≠ T224), Y324 (≠ P346), H370 (= H390), E414 (= E434), N451 (= N471)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
28% identity, 84% coverage: 54:476/503 of query aligns to 33:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (≠ A88), G70 (= G90), T71 (≠ A91), G72 (= G92), T73 (= T93), G74 (= G94), G78 (= G98), V79 (≠ A99), L90 (= L110), P132 (= P152), G133 (≠ S153), A134 (≠ S154), G140 (= G162), M141 (≠ N163), A143 (= A165), T144 (≠ E166), A146 (≠ S168), S147 (≠ G169), E200 (= E218), G201 (= G219), I206 (≠ T224), H370 (= H390), E414 (= E434), N451 (= N471)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R341), W323 (≠ F345), H415 (= H435)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
28% identity, 84% coverage: 54:476/503 of query aligns to 33:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (≠ A88), G70 (= G90), T71 (≠ A91), G72 (= G92), T73 (= T93), G74 (= G94), G78 (= G98), V79 (≠ A99), L90 (= L110), P132 (= P152), G133 (≠ S153), A134 (≠ S154), G140 (= G162), M141 (≠ N163), A143 (= A165), T144 (≠ E166), A146 (≠ S168), S147 (≠ G169), E200 (= E218), G201 (= G219), I206 (≠ T224), H370 (= H390), E414 (= E434), N451 (= N471)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R341), H415 (= H435)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
28% identity, 84% coverage: 54:476/503 of query aligns to 33:456/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (≠ A88), G70 (= G90), T71 (≠ A91), G72 (= G92), T73 (= T93), G74 (= G94), G78 (= G98), V79 (≠ A99), L90 (= L110), P132 (= P152), G133 (≠ S153), A134 (≠ S154), G140 (= G162), M141 (≠ N163), A143 (= A165), T144 (≠ E166), A146 (≠ S168), S147 (≠ G169), E200 (= E218), G201 (= G219), I206 (≠ T224), Y324 (≠ P346), H370 (= H390), E414 (= E434), N451 (= N471)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ L95), R319 (= R341), W323 (≠ F345), H415 (= H435)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
28% identity, 84% coverage: 54:476/503 of query aligns to 33:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R341), W322 (≠ F345), H369 (= H390), H376 (= H397), H413 (= H435)
- binding flavin-adenine dinucleotide: P68 (≠ A88), G70 (= G90), T71 (≠ A91), G72 (= G92), T73 (= T93), G74 (= G94), G78 (= G98), V79 (≠ A99), L90 (= L110), P132 (= P152), G133 (≠ S153), A134 (≠ S154), G140 (= G162), M141 (≠ N163), A143 (= A165), T144 (≠ E166), A146 (≠ S168), S147 (≠ G169), E200 (= E218), G201 (= G219), I206 (≠ T224), W322 (≠ F345), E412 (= E434), H413 (= H435), N449 (= N471)
- binding manganese (ii) ion: H369 (= H390), H376 (= H397), E412 (= E434)
Sites not aligning to the query:
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
28% identity, 84% coverage: 54:476/503 of query aligns to 33:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R341), W322 (≠ F345), S336 (≠ C357), H369 (= H390), H376 (= H397), H413 (= H435)
- binding flavin-adenine dinucleotide: P68 (≠ A88), G70 (= G90), T71 (≠ A91), G72 (= G92), T73 (= T93), G74 (= G94), G78 (= G98), V79 (≠ A99), L90 (= L110), P132 (= P152), G133 (≠ S153), A134 (≠ S154), G140 (= G162), M141 (≠ N163), A143 (= A165), T144 (≠ E166), A146 (≠ S168), S147 (≠ G169), E200 (= E218), G201 (= G219), I206 (≠ T224), E412 (= E434), N449 (= N471)
- binding manganese (ii) ion: H369 (= H390), H376 (= H397), E412 (= E434)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
28% identity, 86% coverage: 45:476/503 of query aligns to 21:465/465 of 3pm9A
- active site: A149 (≠ S168), L159 (= L178)
- binding flavin-adenine dinucleotide: P69 (≠ A88), Q70 (≠ R89), G71 (= G90), G72 (≠ A91), N73 (≠ G92), T74 (= T93), G75 (= G94), L76 (= L95), G79 (= G98), Q80 (≠ A99), L91 (= L110), L133 (≠ P152), G134 (≠ S153), A135 (≠ S154), C139 (= C158), T140 (= T159), G142 (= G161), G143 (= G162), S146 (≠ A165), T147 (≠ E166), A149 (≠ S168), G150 (= G169), E200 (= E218), G201 (= G219), I205 (≠ V223), I206 (≠ T224), E423 (= E434)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 90% coverage: 23:476/503 of query aligns to 29:496/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
27% identity, 93% coverage: 12:478/503 of query aligns to 46:519/521 of Q8N465
- S109 (≠ E69) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V87) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (≠ A91) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ L107) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ F113) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V132) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A149) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A165) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ I191) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G193) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (= D330) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R341) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ F345) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ D354) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ L356) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ E378) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ C385) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H390) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G392) to V: slight reduction in catalytic activity
- N439 (= N395) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H397) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ L399) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I400) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ F402) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E434) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H435) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G436) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
Query Sequence
>RR42_RS29885 FitnessBrowser__Cup4G11:RR42_RS29885
MNATRDGWLAHPTDAERREARRAEVVSALEGVLPRDLILSQREDTQPFECDGLTAYRAQP
LVVVLPETEEQVVAILRTCKTLGAPVVARGAGTGLSGGALPHEMGVLLSLARFNRIVRVD
PVSCTAVVQCGVRNAAISEAAATYGLYYAPDPSSQIACTIGGNVAENSGGVHCLKYGLTL
QNVMKVRGYTIQGEAIEFGSEALDVPGLDLLGVVVGSEGMLAVTLEVTVKLIPKPELARC
IVASFDTVEAAGDAVANVIAAGIIPAGLELMDKPMTAAVEDFVHAGYDLDAAAILLCESD
GTALEVEDEIVKMNAVLTASGATRLEASQDEAQRLRFWSGRKNAFPATGRMSPDYLCMDS
TIPRKSLAAILRAISEMEVRYGLRCVNVFHAGDGNLHPLILFDANNPEELHQAEQFGAEI
LETSVTLGGTVTGEHGVGVEKLNSMCVQFSGAEREQMFALKRAFDPQSLLNPGKVIPTLH
RCAEYGRMTVRRGMLPHPEIPRF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory