SitesBLAST
Comparing RR42_RS29935 FitnessBrowser__Cup4G11:RR42_RS29935 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4x28A Crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis (see paper)
34% identity, 100% coverage: 1:393/393 of query aligns to 1:381/386 of 4x28A
- active site: Y122 (= Y128), S123 (= S129), E240 (= E244), G365 (= G377), M377 (≠ Q389)
- binding dihydroflavine-adenine dinucleotide: I120 (≠ Q126), Y122 (= Y128), S123 (= S129), G128 (= G134), T129 (≠ S135), W153 (= W159), S155 (≠ T161), F363 (≠ I375), T367 (≠ S379), E369 (= E381), V370 (= V382)
I6YCA3 Acyl-CoA dehydrogenase FadE26; ACAD; 3-oxocholest-4-en-26-oyl-CoA dehydrogenase alpha subunit; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 100% coverage: 1:393/393 of query aligns to 1:394/400 of I6YCA3
- IGYS 127:130 (≠ QGYS 126:129) binding
- T136 (≠ S135) binding
- S162 (≠ T161) binding
- E247 (= E244) mutation to A: Loss of dehydrogenase activity.
- TNE 380:382 (≠ SNE 379:381) binding
6wy8B Tcur3481-tcur3483 steroid acad (see paper)
31% identity, 100% coverage: 1:393/393 of query aligns to 1:380/384 of 6wy8B
- active site: Y126 (= Y128), T127 (≠ S129), E241 (= E244), T376 (≠ Q389)
- binding flavin-adenine dinucleotide: I124 (≠ Q126), Y126 (= Y128), T127 (≠ S129), G132 (= G134), T133 (≠ S135), F157 (≠ W159), S159 (≠ T161), V359 (vs. gap), F362 (≠ I375), G363 (≠ Y376), V366 (≠ S379), E368 (= E381)
6wy9A Tcur3481-tcur3483 steroid acad g363a variant (see paper)
31% identity, 98% coverage: 10:393/393 of query aligns to 6:376/380 of 6wy9A
- active site: Y122 (= Y128), T123 (≠ S129), E237 (= E244), T372 (≠ Q389)
- binding dihydroflavine-adenine dinucleotide: I120 (≠ Q126), Y122 (= Y128), T123 (≠ S129), G128 (= G134), T129 (≠ S135), F153 (≠ W159), S155 (≠ T161), F358 (≠ I375), V362 (≠ S379), E364 (= E381)
P71858 Acyl-CoA dehydrogenase FadE29; ACAD; 3-oxo-23,24-bisnorchol-4-en-22-oyl-CoA dehydrogenase beta subunit; 3-oxo-4-pregnene-20-carboxyl-CoA dehydrogenase beta subunit; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 86% coverage: 50:388/393 of query aligns to 48:376/387 of P71858
- E241 (= E244) mutation to Q: Unable to dehydrogenate pregnene-carboxyl-CoA ester.
P96855 Acyl-CoA dehydrogenase FadE34; ACAD; 3-oxochol-4-en-24-oyl-CoA dehydrogenase; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 88% coverage: 50:393/393 of query aligns to 388:708/711 of P96855
- E581 (= E244) mutation to Q: Displays less than 1% activity with cholyl-CoA as substrate. Still binds FAD.
Sites not aligning to the query:
- 236 R→A: Displays less than 2% activity with cholyl-CoA as substrate. Cannot bind FAD.
8hk0B Crystal structure of fic32-33 complex from streptomyces ficellus nrrl 8067 (see paper)
31% identity, 83% coverage: 1:327/393 of query aligns to 1:324/379 of 8hk0B
Sites not aligning to the query:
2pg0A Crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus
28% identity, 87% coverage: 50:389/393 of query aligns to 45:376/380 of 2pg0A
- active site: M124 (≠ Y128), T125 (≠ S129), E243 (= E244), A364 (≠ G377), R376 (≠ Q389)
- binding flavin-adenine dinucleotide: I122 (≠ Q126), M124 (≠ Y128), T125 (≠ S129), G130 (= G134), S131 (= S135), F155 (≠ W159), I156 (≠ T160), T157 (= T161), R269 (= R263), F272 (≠ A266), F279 (≠ D273), Q337 (≠ L331), L338 (≠ A332), G340 (= G334), G341 (≠ P335), V359 (≠ K372), I362 (= I375), Y363 (= Y376), T366 (≠ S379), E368 (= E381), M369 (≠ V382)
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
29% identity, 89% coverage: 43:393/393 of query aligns to 42:378/379 of 1ukwB
- active site: L124 (≠ Y128), S125 (= S129), T241 (≠ E244), E362 (≠ G377), R374 (≠ Q389)
- binding cobalt (ii) ion: D145 (= D149), H146 (≠ K150)
- binding flavin-adenine dinucleotide: F122 (≠ Q126), L124 (≠ Y128), S125 (= S129), G130 (= G134), S131 (= S135), W155 (= W159), S157 (≠ T161), K200 (= K203), L357 (≠ K372), Y361 (= Y376), E362 (≠ G377), T364 (≠ S379), E366 (= E381), L370 (≠ N385)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
29% identity, 89% coverage: 43:393/393 of query aligns to 42:378/379 of 1ukwA
- active site: L124 (≠ Y128), S125 (= S129), T241 (≠ E244), E362 (≠ G377), R374 (≠ Q389)
- binding flavin-adenine dinucleotide: F122 (≠ Q126), L124 (≠ Y128), S125 (= S129), G130 (= G134), S131 (= S135), W155 (= W159), S157 (≠ T161), L357 (≠ K372), Y361 (= Y376), E362 (≠ G377), T364 (≠ S379), E366 (= E381), L370 (≠ N385)
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
26% identity, 99% coverage: 3:392/393 of query aligns to 1:377/379 of 6fahD
- active site: L124 (≠ Y128), T125 (≠ S129), G241 (≠ E244), G374 (≠ Q389)
- binding flavin-adenine dinucleotide: F122 (≠ Q126), L124 (≠ Y128), T125 (≠ S129), R152 (≠ Q156), F155 (≠ W159), T157 (= T161), E198 (vs. gap), R267 (≠ E257), Q269 (≠ R259), F270 (≠ R260), I274 (= I264), F277 (≠ A267), Q335 (≠ L331), I336 (≠ A332), G339 (≠ P335), Y361 (= Y376), T364 (≠ S379), Q366 (≠ E381)
P51174 Long-chain specific acyl-CoA dehydrogenase, mitochondrial; LCAD; EC 1.3.8.8 from Mus musculus (Mouse) (see paper)
25% identity, 87% coverage: 51:392/393 of query aligns to 94:427/430 of P51174
- K318 (vs. gap) modified: N6-acetyllysine; mutation to R: Reduces activity by 37%; reduces activity by 80% when associated with R-322.
- K322 (vs. gap) modified: N6-acetyllysine; alternate; mutation to R: Reduces activity by 23%; reduces activity by 80% when associated with R-318.
Sites not aligning to the query:
- 42 modified: N6-acetyllysine; K→R: Reduces activity by 90% when associated with R-318 and R-322.
3r7kA Crystal structure of a probable acyl coa dehydrogenase from mycobacterium abscessus atcc 19977 / dsm 44196 (see paper)
34% identity, 52% coverage: 47:249/393 of query aligns to 42:247/378 of 3r7kA
Sites not aligning to the query:
- active site: 363, 375
- binding dihydroflavine-adenine dinucleotide: 268, 270, 271, 275, 278, 281, 336, 337, 340, 358, 365, 367
5iduC Crystal structure of an acyl-coa dehydrogenase domain protein from burkholderia phymatum bound to fad
25% identity, 99% coverage: 5:392/393 of query aligns to 25:396/405 of 5iduC
- active site: L145 (≠ Y128), S146 (= S129), F260 (≠ E244), E381 (≠ G377), R393 (≠ Q389)
- binding flavin-adenine dinucleotide: F143 (≠ Q126), L145 (≠ Y128), S146 (= S129), G151 (= G134), S152 (= S135), W176 (= W159), S178 (≠ T161), R286 (≠ E268), M288 (= M270), F296 (≠ D273), Q354 (≠ T347), L355 (≠ E348), G358 (= G351), A376 (≠ K372), Y380 (= Y376), A383 (≠ S379), E385 (= E381)
1ivhA Structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity (see paper)
28% identity, 62% coverage: 5:249/393 of query aligns to 8:254/387 of 1ivhA
- active site: M130 (≠ Y128), S131 (= S129), E249 (= E244)
- binding coenzyme a persulfide: S137 (= S135), S185 (≠ A183), R186 (vs. gap), V239 (≠ W234), Y240 (≠ T235), M243 (≠ K238), E249 (= E244), R250 (= R245)
- binding flavin-adenine dinucleotide: L128 (≠ Q126), M130 (≠ Y128), S131 (= S129), G136 (= G134), S137 (= S135), W161 (= W159), T163 (= T161)
Sites not aligning to the query:
- active site: 370, 382
- binding coenzyme a persulfide: 369, 370, 371, 375
- binding flavin-adenine dinucleotide: 275, 278, 285, 288, 343, 344, 347, 372, 374
3mdeA Crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate (see paper)
30% identity, 54% coverage: 54:265/393 of query aligns to 50:268/385 of 3mdeA
- active site: V125 (≠ Y128), T126 (≠ S129), T245 (≠ E244)
- binding octanoyl-coenzyme a: T86 (≠ R88), E89 (≠ P91), L93 (≠ V95), S132 (= S135), V134 (≠ L137), S181 (≠ G184), F235 (≠ W234), M239 (≠ K238), F242 (≠ L241)
- binding flavin-adenine dinucleotide: Y123 (≠ Q126), V125 (≠ Y128), T126 (≠ S129), G131 (= G134), S132 (= S135), W156 (= W159), I157 (≠ T160), T158 (= T161)
Sites not aligning to the query:
- active site: 366, 378
- binding octanoyl-coenzyme a: 314, 365, 366, 367
- binding flavin-adenine dinucleotide: 271, 273, 274, 278, 281, 339, 340, 343, 361, 368, 370
3mddA Crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate (see paper)
30% identity, 54% coverage: 54:265/393 of query aligns to 50:268/385 of 3mddA
Sites not aligning to the query:
- active site: 366, 378
- binding flavin-adenine dinucleotide: 271, 273, 274, 281, 339, 340, 343, 361, 368, 370
1udyA Medium-chain acyl-coa dehydrogenase with 3-thiaoctanoyl-coa (see paper)
30% identity, 54% coverage: 54:265/393 of query aligns to 50:268/385 of 1udyA
- active site: V125 (≠ Y128), T126 (≠ S129), T245 (≠ E244)
- binding 3-thiaoctanoyl-coenzyme a: L93 (≠ V95), Y123 (≠ Q126), S132 (= S135), S181 (≠ G184), F235 (≠ W234), M239 (≠ K238), F242 (≠ L241), V249 (≠ I248)
- binding flavin-adenine dinucleotide: Y123 (≠ Q126), T126 (≠ S129), G131 (= G134), S132 (= S135), W156 (= W159), T158 (= T161)
Sites not aligning to the query:
- active site: 366, 378
- binding 3-thiaoctanoyl-coenzyme a: 314, 365, 366, 367, 371, 375
- binding flavin-adenine dinucleotide: 273, 274, 339, 340, 343, 368, 370
8sgrA Isovaleryl-CoA dehydrogenase, mitochondrial (see paper)
28% identity, 62% coverage: 5:249/393 of query aligns to 12:258/393 of 8sgrA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 279, 282, 286, 289, 347, 348, 351, 369, 375, 376, 382
P41367 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial; MCAD; EC 1.3.8.7 from Sus scrofa (Pig) (see 2 papers)
30% identity, 54% coverage: 54:265/393 of query aligns to 85:303/421 of P41367
- 158:167 (vs. 126:135, 50% identical) binding in other chain
- S167 (= S135) binding
- WIT 191:193 (≠ WTT 159:161) binding in other chain
- S216 (≠ G184) binding
- D278 (≠ S242) binding
- R281 (= R245) binding
Sites not aligning to the query:
- 306:308 binding
- 316:317 binding in other chain
- 349 binding
- 351 binding
- 374:378 binding
- 401 active site, Proton acceptor; binding
- 402:405 binding in other chain
Query Sequence
>RR42_RS29935 FitnessBrowser__Cup4G11:RR42_RS29935
MDLNFTEEEQEFRKEVHAWIDAHLPKEISHKVHNGLQLSRTDMQRWHQILGKKGWLTYKW
PVEFGGTGWTPVQRHIFEEECALAGAPRLVPYGPVMVAPVIMAFGNAEQQARFLPGIVTG
DVWWSQGYSEPGSGSDLASLKTRAERKGDKYIVNGQKIWTTLAQYGEWIFCLVRTNTEGK
PQAGISFLLIDMRSPGVTVRPIKLLDGECEVNEVWFDNVEVPVENLIGEENKGWTYAKHL
LSHERSNIAEVGRAKRELRRLKRIAAAEGMMDDPRFKDEVSKLEVDIIALEMLVLRVISA
EKSGKNPLDIAGLLKIRGSEIQQRYSELMMLAAGPYSLPFIQDAMLTEWDGEFPGGERRN
APLAATYFNLRKTTIYGGSNEVQRNIVSQVVLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory