Comparing RR42_RS30140 FitnessBrowser__Cup4G11:RR42_RS30140 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7pldB Caulobacter crescentus xylonolactonase with (r)-4-hydroxy-2- pyrrolidone (see paper)
48% identity, 97% coverage: 8:289/292 of query aligns to 7:287/289 of 7pldB
7plbB Caulobacter crescentus xylonolactonase with d-xylose (see paper)
48% identity, 97% coverage: 8:289/292 of query aligns to 7:287/289 of 7plbB
Q9A9Z1 D-xylonolactone lactonase; Xylono-1,5-lactonase; EC 3.1.1.110 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
48% identity, 97% coverage: 8:289/292 of query aligns to 7:287/289 of Q9A9Z1
Q15493 Regucalcin; RC; Gluconolactonase; GNL; Senescence marker protein 30; SMP-30; EC 3.1.1.17 from Homo sapiens (Human) (see 2 papers)
34% identity, 92% coverage: 8:276/292 of query aligns to 8:284/299 of Q15493
4gncA Human smp30/gnl-1,5-ag complex (see paper)
34% identity, 92% coverage: 8:276/292 of query aligns to 7:283/298 of 4gncA
Sites not aligning to the query:
3g4hA Crystal structure of human senescence marker protein-30 (zinc bound) (see paper)
34% identity, 92% coverage: 8:276/292 of query aligns to 6:282/297 of 3g4hA
4gnaA Mouse smp30/gnl-xylitol complex (see paper)
34% identity, 92% coverage: 8:276/292 of query aligns to 6:282/297 of 4gnaA
4gn9A Mouse smp30/gnl-glucose complex (see paper)
34% identity, 92% coverage: 8:276/292 of query aligns to 6:282/297 of 4gn9A
4gn8A Mouse smp30/gnl-1,5-ag complex (see paper)
34% identity, 92% coverage: 8:276/292 of query aligns to 6:282/297 of 4gn8A
Sites not aligning to the query:
4gn7A Mouse smp30/gnl (see paper)
34% identity, 92% coverage: 8:276/292 of query aligns to 6:282/297 of 4gn7A
5gx1A Luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 1.1 mgy (1st measurement) (see paper)
34% identity, 82% coverage: 16:255/292 of query aligns to 15:271/307 of 5gx1A
5d9bA Luciferin-regenerating enzyme solved by siras using xfel (refined against native data) (see paper)
34% identity, 82% coverage: 16:255/292 of query aligns to 15:271/307 of 5d9bA
7rizA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound 2-hydroxyquinoline (see paper)
31% identity, 62% coverage: 77:258/292 of query aligns to 94:287/306 of 7rizA
Sites not aligning to the query:
7risA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound phosphate (see paper)
31% identity, 62% coverage: 77:258/292 of query aligns to 85:274/293 of 7risA
Sites not aligning to the query:
8dk0A Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound (s)gamma- valerolactone (see paper)
30% identity, 62% coverage: 77:258/292 of query aligns to 89:274/293 of 8dk0A
Sites not aligning to the query:
8djzA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound product (see paper)
30% identity, 62% coverage: 77:258/292 of query aligns to 89:274/293 of 8djzA
Sites not aligning to the query:
8djfA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound tetrahedral intermediate (see paper)
30% identity, 62% coverage: 77:258/292 of query aligns to 89:274/293 of 8djfA
Sites not aligning to the query:
3o4pA Dfpase at 0.85 angstrom resolution (h atoms included) (see paper)
29% identity, 52% coverage: 103:253/292 of query aligns to 120:285/314 of 3o4pA
Sites not aligning to the query:
Q7SIG4 Diisopropyl-fluorophosphatase; DFPase; EC 3.1.8.2 from Loligo vulgaris (Common European squid) (see 4 papers)
29% identity, 52% coverage: 103:253/292 of query aligns to 120:285/314 of Q7SIG4
Sites not aligning to the query:
2gvvA Structure of diisopropyl fluorophosphatase (dfpase) in complex with dicyclopentylphosphoroamidate (dcppa) (see paper)
29% identity, 52% coverage: 103:253/292 of query aligns to 118:283/309 of 2gvvA
Sites not aligning to the query:
>RR42_RS30140 FitnessBrowser__Cup4G11:RR42_RS30140
MKDNHPLCVWQLGAELGEGPVWHQGSSAVYFVDIKGRRIHRFAIATGAMRSWPVDSQPGF
IVPLDDGGFLCGMQDGLYRFDPADGACRRLKEVEPDLPGNRINDGFVDPAGRLWFGTMDD
GEAAPSGSLYQVGDDGRTWRRDSGYVITNGPAMSPDARTLYHADTVKRLVYAFDVGQDGA
LSRRREFARLCGTGYPDGMAVDADGHLWIAVFGGARIERWSPDGRLAGVVRFPCDNVTKL
AFGGDDLRTVYVTTARKGLSPAALALQPLAGGLFSFRAPTRGLPQMSCKARF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory