SitesBLAST
Comparing RR42_RS30145 FitnessBrowser__Cup4G11:RR42_RS30145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5wjsA Crystal structure of oxidoreductase (short chain dehydrogenase/reductase family) from burkholderia thailandensis complexed with nadh
47% identity, 98% coverage: 3:252/255 of query aligns to 8:257/258 of 5wjsA
- active site: G27 (= G22), S152 (= S147), Y162 (≠ L157), Y165 (= Y160), K169 (= K164)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G23 (= G18), T26 (≠ G21), I28 (= I23), D47 (= D42), L48 (≠ V43), D73 (= D68), L74 (= L69), N100 (= N95), A102 (≠ G97), L150 (= L145), G151 (= G146), S152 (= S147), K169 (= K164), P195 (= P190), G196 (= G191), W197 (≠ A192), V198 (= V193), K202 (≠ R197)
7wwxA Crystal structure of herbaspirillum huttiense l-arabinose 1- dehydrogenase (NAD bound form) (see paper)
45% identity, 99% coverage: 1:252/255 of query aligns to 1:253/254 of 7wwxA
- binding nicotinamide-adenine-dinucleotide: G18 (= G18), T21 (≠ G21), I23 (= I23), D42 (= D42), I43 (≠ V43), C68 (= C67), D69 (= D68), L70 (= L69), N96 (= N95), A98 (≠ G97), F146 (≠ L145), S147 (≠ G146), S148 (= S147), Y161 (= Y160), K165 (= K164), P191 (= P190), G192 (= G191), W193 (≠ A192), V194 (= V193), R198 (= R197)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
32% identity, 95% coverage: 9:251/255 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), M16 (≠ I23), D35 (= D42), I36 (≠ V43), I62 (≠ L69), N88 (= N95), G90 (= G97), I138 (≠ L145), S140 (= S147), Y152 (= Y160), K156 (= K164), I185 (≠ V193)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
32% identity, 95% coverage: 9:251/255 of query aligns to 3:242/248 of Q9KJF1
- S15 (≠ G21) binding
- D36 (= D42) binding
- D62 (= D68) binding
- I63 (≠ L69) binding
- N89 (= N95) binding
- Y153 (= Y160) binding
- K157 (= K164) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2ewmB Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 (see paper)
33% identity, 95% coverage: 9:251/255 of query aligns to 3:243/247 of 2ewmB
- active site: G16 (= G22), S139 (= S147), Y149 (≠ L157), Y152 (= Y160), K156 (= K164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), N15 (≠ G21), G16 (= G22), I17 (= I23), D36 (= D42), L37 (≠ V43), C59 (= C67), D60 (= D68), V61 (≠ L69), N87 (= N95), S139 (= S147), Y152 (= Y160), K156 (= K164), P182 (= P190), S183 (≠ G191), L184 (≠ A192), V185 (= V193), T189 (≠ R197)
Q5P5I4 (S)-1-Phenylethanol dehydrogenase; EC 1.1.1.311 from Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) (see 2 papers)
33% identity, 95% coverage: 9:251/255 of query aligns to 5:245/249 of Q5P5I4
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
31% identity, 96% coverage: 10:255/255 of query aligns to 4:244/244 of 6t62A
- active site: G16 (= G22), S138 (= S147), Y151 (= Y160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G18), S14 (≠ G20), R15 (≠ G21), A36 (≠ D42), T37 (≠ V43), L58 (≠ F64), D59 (= D68), V60 (≠ L69), N86 (= N95), A87 (= A96), G88 (= G97), I89 (≠ R98), I136 (≠ L145), S137 (≠ G146), S138 (= S147), Y151 (= Y160), K155 (= K164), P181 (= P190), G182 (= G191), I184 (≠ V193), M188 (≠ R197)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
31% identity, 96% coverage: 10:255/255 of query aligns to 4:244/244 of 6wprA
- active site: G16 (= G22), S138 (= S147), Y151 (= Y160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G18), S14 (≠ G20), R15 (≠ G21), T37 (≠ V43), L58 (≠ F64), D59 (= D68), V60 (≠ L69), N86 (= N95), A87 (= A96), G88 (= G97), I89 (≠ R98), I136 (≠ L145), Y151 (= Y160), K155 (= K164), P181 (= P190)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
32% identity, 96% coverage: 8:252/255 of query aligns to 4:252/255 of 5itvA
- active site: G18 (= G22), S141 (= S147), Y154 (= Y160), K158 (= K164)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G18), S17 (≠ G21), G18 (= G22), I19 (= I23), D38 (= D42), I39 (≠ V43), T61 (≠ C67), I63 (≠ L69), N89 (= N95), G91 (= G97), T139 (≠ L145), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (= G191), I186 (≠ A192), I187 (≠ V193)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
33% identity, 96% coverage: 8:251/255 of query aligns to 5:244/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G18), R18 (≠ G21), G19 (= G22), I20 (= I23), D39 (= D42), R40 (≠ V43), C63 (= C67), I65 (≠ L69), N91 (= N95), G93 (= G97), I94 (≠ R98), V114 (= V118), Y155 (= Y160), K159 (= K164), I188 (≠ V193), T190 (= T195), T193 (vs. gap)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
29% identity, 95% coverage: 9:251/255 of query aligns to 3:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), Q15 (≠ G21), G16 (= G22), I17 (= I23), D36 (= D42), V63 (≠ L69), N89 (= N95), A91 (≠ G97), S94 (≠ D100), I142 (≠ L145), S143 (≠ G146), S144 (= S147), Y157 (= Y160), K161 (= K164), P187 (= P190), H188 (≠ G191), I190 (≠ V193), I194 (vs. gap)
1zk1A Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
32% identity, 96% coverage: 9:252/255 of query aligns to 4:248/251 of 1zk1A
- active site: G17 (= G22), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding 1-phenylethanone: A93 (≠ D99), N95 (≠ R101), Y155 (= Y160), Y189 (≠ A192)
- binding nicotinamide-adenine-dinucleotide: G13 (= G18), L16 (≠ G21), I18 (= I23), D37 (= D42), H61 (≠ C67), D62 (= D68), S63 (≠ L69), N89 (= N95), A90 (= A96), I92 (≠ R98), M140 (≠ L145), Y155 (= Y160), G188 (= G191), I190 (≠ V193), L194 (= L200)
1zjzA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
32% identity, 96% coverage: 9:252/255 of query aligns to 4:248/251 of 1zjzA
- active site: G17 (= G22), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding nicotinamide-adenine-dinucleotide: G13 (= G18), L16 (≠ G21), I18 (= I23), D37 (= D42), D62 (= D68), N89 (= N95), A90 (= A96), G91 (= G97), I92 (≠ R98), Y155 (= Y160), G188 (= G191), I190 (≠ V193), L194 (= L200)
- binding (1r)-1-phenylethanol: A93 (≠ D99), N95 (≠ R101), L152 (= L157), Y155 (= Y160)
1zjyA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh (see paper)
32% identity, 96% coverage: 9:252/255 of query aligns to 4:248/251 of 1zjyA
- active site: G17 (= G22), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G18), L16 (≠ G21), G17 (= G22), I18 (= I23), D37 (= D42), D62 (= D68), N89 (= N95), A90 (= A96), G91 (= G97), I92 (≠ R98), Y155 (= Y160), G188 (= G191), I190 (≠ V193), L194 (= L200)
- binding (1r)-1-phenylethanol: A93 (≠ D99), N95 (≠ R101), L152 (= L157), Y155 (= Y160), Y189 (≠ A192)
5ha5D Crystal structure of an NAD-bound oxidoreductase from brucella ovis
33% identity, 97% coverage: 9:255/255 of query aligns to 4:244/244 of 5ha5D
- active site: G17 (= G22), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding nicotinamide-adenine-dinucleotide: G13 (= G18), R16 (≠ G21), G17 (= G22), L18 (≠ I23), D37 (= D42), I38 (≠ V43), L62 (≠ C67), D63 (= D68), V64 (≠ L69), N90 (= N95), A91 (= A96), S142 (= S147), Y155 (= Y160), K159 (= K164), G186 (= G191), M188 (≠ L200), S190 (≠ W202)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
28% identity, 96% coverage: 9:252/255 of query aligns to 4:249/252 of 1vl8B
- active site: G17 (= G22), S143 (= S147), I154 (≠ L157), Y157 (= Y160), K161 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G18), R16 (≠ G21), G17 (= G22), L18 (≠ I23), S37 (≠ A48), R38 (= R49), C63 (= C67), D64 (= D68), V65 (≠ L69), A91 (≠ N95), A92 (= A96), G93 (= G97), I94 (≠ R98), V114 (= V118), I141 (≠ L145), S143 (= S147), Y157 (= Y160), K161 (= K164), P187 (= P190), G188 (= G191), Y190 (≠ V193), T192 (= T195), M194 (≠ R197), T195 (≠ Q198)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
31% identity, 96% coverage: 8:252/255 of query aligns to 4:224/227 of 5itvD
- active site: G18 (= G22), S141 (= S147), Y154 (= Y160), K158 (= K164)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G18), S17 (≠ G21), G18 (= G22), I19 (= I23), D38 (= D42), I39 (≠ V43), T61 (≠ C67), D62 (= D68), I63 (≠ L69), N89 (= N95), T139 (≠ L145), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (= G191), I187 (≠ V193)
1zk4A Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and NADP (see paper)
31% identity, 96% coverage: 9:252/255 of query aligns to 4:248/251 of 1zk4A
- active site: G17 (= G22), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding 1-phenylethanone: A93 (≠ D99), Y155 (= Y160), Y189 (≠ A192)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G18), T15 (≠ G20), L16 (≠ G21), I18 (= I23), T36 (≠ I41), G37 (≠ D42), R38 (≠ V43), H61 (≠ C67), D62 (= D68), N89 (= N95), A90 (= A96), G91 (= G97), I92 (≠ R98), Y155 (= Y160), G188 (= G191), I190 (≠ V193), T192 (= T195), L194 (= L200)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
29% identity, 95% coverage: 9:251/255 of query aligns to 5:241/244 of 4nbuB
- active site: G18 (= G22), N111 (= N119), S139 (= S147), Q149 (≠ L157), Y152 (= Y160), K156 (= K164)
- binding acetoacetyl-coenzyme a: D93 (≠ R101), K98 (≠ A106), S139 (= S147), N146 (≠ V154), V147 (≠ P155), Q149 (≠ L157), Y152 (= Y160), F184 (≠ A192), M189 (≠ L200), K200 (≠ L211)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G18), N17 (≠ G21), G18 (= G22), I19 (= I23), D38 (= D42), F39 (≠ V43), V59 (≠ C67), D60 (= D68), V61 (≠ L69), N87 (= N95), A88 (= A96), G89 (= G97), I90 (≠ R98), T137 (≠ L145), S139 (= S147), Y152 (= Y160), K156 (= K164), P182 (= P190), F184 (≠ A192), T185 (≠ V193), T187 (= T195), M189 (≠ L200)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
29% identity, 96% coverage: 9:252/255 of query aligns to 3:245/248 of 6ixmC
- active site: G16 (= G22), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), S15 (≠ G21), G16 (= G22), I17 (= I23), D36 (= D42), I37 (≠ V43), A61 (≠ C67), D62 (= D68), T63 (≠ L69), N89 (= N95), A90 (= A96), M140 (≠ L145), S142 (= S147), Y155 (= Y160), K159 (= K164), P185 (= P190), A186 (≠ G191), Y187 (≠ A192), I188 (≠ V193), L192 (= L200)
Query Sequence
>RR42_RS30145 FitnessBrowser__Cup4G11:RR42_RS30145
MSYAIYPSLKEKSVVITGGGGGIGAEMVGAFARQGAHVHFIDVCEVGARQLQDALTAEGL
HTVFHPCDLRDIGATTAVFDRIAQACGPIGVLVNNAGRDDRHQVDAVTPSDWEECIAVNL
RHQFFCAQLAAAGMRTARTGVILNLGSASWHVAVPDLSIYMTAKAGIEGLTRGLARDLGR
DGIRVNCIVPGAVRTPRQTLLWQTAQSEARLLQSQCLPARIEPRHVAAMALFLASDDAER
CSGREYFVDAGYFGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory