Comparing RR42_RS30175 FitnessBrowser__Cup4G11:RR42_RS30175 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2x41A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with glucose (see paper)
34% identity, 92% coverage: 54:706/708 of query aligns to 35:713/715 of 2x41A
2x42A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with alpha-d-glucose (see paper)
34% identity, 92% coverage: 54:706/708 of query aligns to 35:713/715 of 2x42A
5wabA Crystal structure of bifidobacterium adolescentis gh3 beta-glucosidase (see paper)
34% identity, 90% coverage: 58:693/708 of query aligns to 22:637/674 of 5wabA
7zgzX Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside hydrolysed to xylose
28% identity, 98% coverage: 11:705/708 of query aligns to 5:736/753 of 7zgzX
7zdyW Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside
28% identity, 98% coverage: 11:705/708 of query aligns to 5:747/763 of 7zdyW
7zb3A Crystal structure of beta-xylosidase from thermotoga maritima in complex with xylohexaose hydrolysed to xylobiose
28% identity, 98% coverage: 11:705/708 of query aligns to 5:747/765 of 7zb3A
8c7fA Crystal structure of beta-xylosidase mutant (d281n, e517q) from thermotoga maritima in complex with xylopentaose
27% identity, 98% coverage: 11:705/708 of query aligns to 5:756/772 of 8c7fA
6jxgA Crystasl structure of beta-glucosidase d2-bgl from chaetomella raphigera (see paper)
30% identity, 91% coverage: 59:699/708 of query aligns to 41:710/713 of 6jxgA
4i8dB Crystal structure of beta-d-glucoside glucohydrolase from trichoderma reesei (see paper)
27% identity, 90% coverage: 66:701/708 of query aligns to 52:713/714 of 4i8dB
Sites not aligning to the query:
4i8dA Crystal structure of beta-d-glucoside glucohydrolase from trichoderma reesei (see paper)
27% identity, 90% coverage: 66:701/708 of query aligns to 49:710/711 of 4i8dA
Sites not aligning to the query:
4iihA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with thiocellobiose (see paper)
30% identity, 80% coverage: 53:618/708 of query aligns to 48:654/833 of 4iihA
Sites not aligning to the query:
4iicA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with isofagomine (see paper)
30% identity, 80% coverage: 53:618/708 of query aligns to 48:654/833 of 4iicA
Sites not aligning to the query:
4iigA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with d-glucose (see paper)
30% identity, 78% coverage: 53:601/708 of query aligns to 48:643/834 of 4iigA
Sites not aligning to the query:
4iifA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with castanospermine (see paper)
30% identity, 78% coverage: 53:601/708 of query aligns to 48:643/833 of 4iifA
Sites not aligning to the query:
4iieA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with calystegine b(2) (see paper)
30% identity, 78% coverage: 53:601/708 of query aligns to 48:643/834 of 4iieA
Sites not aligning to the query:
4iidA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with 1-deoxynojirimycin (see paper)
30% identity, 78% coverage: 53:601/708 of query aligns to 48:643/834 of 4iidA
Sites not aligning to the query:
4iibA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus (see paper)
30% identity, 78% coverage: 53:601/708 of query aligns to 48:643/834 of 4iibA
Sites not aligning to the query:
6sz6A Chaetomium thermophilum beta-glucosidase (see paper)
32% identity, 77% coverage: 57:601/708 of query aligns to 53:640/836 of 6sz6A
Sites not aligning to the query:
4i3gB Crystal structure of desr, a beta-glucosidase from streptomyces venezuelae in complex with d-glucose. (see paper)
37% identity, 49% coverage: 59:404/708 of query aligns to 33:387/780 of 4i3gB
Sites not aligning to the query:
5fjjA Three-dimensional structures of two heavily n-glycosylated aspergillus sp. Family gh3 beta-d-glucosidases (see paper)
28% identity, 77% coverage: 59:601/708 of query aligns to 54:643/839 of 5fjjA
Sites not aligning to the query:
>RR42_RS30175 FitnessBrowser__Cup4G11:RR42_RS30175
MPSSSSVAAGRDPDALARDTEARMTDDERFSMLYSLMVRVFGTSAREPRVPADVPAVAGY
VKGVPRLGIPPLKLADASLGLRHTDGPDDCATALPAGLAIGATFNPSLARTIGNLIGKEA
RARDFNVALGGGINLVRDVRNGRNFEYISEDPLLSGLIGAEIVSGTQEEGVIAVLKHVSL
NASETNKFFLDAIIDPAAHRESDLLAFQIAIEKSQPGALMGAYNLVNGAYACGNRAILQE
TIKDAMGFKGWVMSDWLAVYGWEFALSGLDQHAGAQLDKQEWFNGPLRQAYEQGKVPKER
ISDMVRRMLRSYYAIGIDQQRAAAPVDFAAHNAVALQAAREGIVLLKNEGQALPLAAGRQ
RIAIIGGYAQTGVLSGDGSSQVMPTSGYAAQVPLRSHPLLGTTVMRLFGSSPLAALRKQL
PEAIIEFDCGAHIADAVAMAKRADIVVMFAYRHEAERFDSPDMTLPFGQDALIEAVANEN
RNLIVVLQTGNPVAMPWRDKARAIVQAWFPGQLGAQAIAEVLTGKINPSGRLPISFPFDV
GQTPHPTLPGSDVELGTPIKVHYHEGAEVGYRWFAKTGRQPLFGFGHGLSYATFAYRDLE
VVDAESLTVAFTVTNTGARQGDDVPQVYLTDAAGDWRMRLLGFERVSLRPGESARVRITA
DPRLLACFQSELGCWRMEAGQYRIALGRSAQDLELSIELCLEEREFGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory