Comparing RR42_RS30510 FitnessBrowser__Cup4G11:RR42_RS30510 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
45% identity, 98% coverage: 1:210/214 of query aligns to 3:212/214 of 2v6kA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
45% identity, 98% coverage: 1:210/214 of query aligns to 1:210/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
45% identity, 98% coverage: 1:210/214 of query aligns to 1:210/212 of O86043
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
37% identity, 99% coverage: 3:213/214 of query aligns to 5:209/212 of 2cz2A
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
37% identity, 99% coverage: 3:213/214 of query aligns to 8:212/216 of Q9WVL0
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
38% identity, 97% coverage: 3:210/214 of query aligns to 4:205/208 of 1fw1A
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
38% identity, 97% coverage: 3:210/214 of query aligns to 8:209/216 of O43708
D2YW48 Probable glutathione S-transferase; EC 2.5.1.18 from Coccidioides immitis (strain RS) (Valley fever fungus)
36% identity, 98% coverage: 1:210/214 of query aligns to 6:224/231 of D2YW48
3n5oA Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione (see paper)
36% identity, 98% coverage: 1:210/214 of query aligns to 4:222/228 of 3n5oA
4kaeA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
39% identity, 98% coverage: 1:210/214 of query aligns to 8:211/220 of 4kaeA
4kdyA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
39% identity, 98% coverage: 1:210/214 of query aligns to 10:213/222 of 4kdyA
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
34% identity, 98% coverage: 1:209/214 of query aligns to 3:212/216 of 4pxoA
8ai8A Crystal structure of glutathione transferase chi 1 from synechocystis sp. Pcc 6803 in complex with glutathione (see paper)
29% identity, 83% coverage: 24:201/214 of query aligns to 24:178/183 of 8ai8A
Sites not aligning to the query:
7pkaA Synechocystis sp. Pcc6803 glutathione transferase chi 1, gsoh bound
29% identity, 83% coverage: 24:201/214 of query aligns to 24:178/183 of 7pkaA
Sites not aligning to the query:
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
24% identity, 92% coverage: 2:198/214 of query aligns to 4:194/201 of 3m3mA
O80852 Glutathione S-transferase F9; AtGSTF9; AtGSTF7; GST class-phi member 9; EC 2.5.1.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 73% coverage: 14:169/214 of query aligns to 15:170/215 of O80852
Sites not aligning to the query:
6f01B Arabidopsis thaliana gstf9, gso3 and gsoh bound (see paper)
28% identity, 73% coverage: 14:169/214 of query aligns to 14:169/212 of 6f01B
Sites not aligning to the query:
6ezyB Arabidopsis thaliana gstf9, gsh and gsoh bound (see paper)
28% identity, 73% coverage: 14:169/214 of query aligns to 14:169/212 of 6ezyB
Sites not aligning to the query:
4kh7B Crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione
27% identity, 94% coverage: 1:202/214 of query aligns to 6:205/212 of 4kh7B
3qawA Crystal structure of a glutathione-s-transferase from antarctic clam laternula elliptica in a complex with glutathione (see paper)
24% identity, 90% coverage: 13:205/214 of query aligns to 15:203/219 of 3qawA
Sites not aligning to the query:
>RR42_RS30510 FitnessBrowser__Cup4G11:RR42_RS30510
MQIYSFFNSSTSYRVRIALALKGLPCDYQPVNIRVGEHRAADYVAAINPSAVVPALVDGD
FHLGQSMAIIDYLDACHPEPRLIPQAAEPRARVLELANVIACDIHPVNNMRILRYLQDTL
GVTPEQKDAWYQHWVDEGLGAVERLLAQHGRGPWCFGDQPTLADCCLVPQIANAQRMGCR
TERFERTMAVYRHACEHPAFQQAEPQRQPDYTAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory