Comparing RR42_RS30800 FitnessBrowser__Cup4G11:RR42_RS30800 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
32% identity, 92% coverage: 5:493/530 of query aligns to 4:474/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 41% coverage: 4:220/530 of query aligns to 1:215/241 of 4u00A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 41% coverage: 5:221/530 of query aligns to 4:230/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 41% coverage: 5:221/530 of query aligns to 4:230/253 of 1g9xB
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 40% coverage: 11:220/530 of query aligns to 9:217/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 40% coverage: 11:220/530 of query aligns to 9:217/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 40% coverage: 11:220/530 of query aligns to 9:217/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 40% coverage: 11:220/530 of query aligns to 9:217/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 40% coverage: 11:220/530 of query aligns to 7:215/240 of 4ymuJ
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 51% coverage: 5:272/530 of query aligns to 1:275/343 of P30750
Sites not aligning to the query:
E9Q876 Glucosylceramide transporter ABCA12; ATP-binding cassette sub-family A member 12; EC 7.6.2.1 from Mus musculus (Mouse) (see 2 papers)
33% identity, 40% coverage: 8:219/530 of query aligns to 1348:1555/2595 of E9Q876
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 51% coverage: 5:272/530 of query aligns to 2:276/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 51% coverage: 5:272/530 of query aligns to 2:276/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 51% coverage: 5:272/530 of query aligns to 2:276/344 of 3tuiC
Q5SSE9 ATP-binding cassette sub-family A member 13; EC 7.6.2.- from Mus musculus (Mouse) (see paper)
30% identity, 41% coverage: 4:219/530 of query aligns to 3808:4020/5034 of Q5SSE9
Sites not aligning to the query:
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
31% identity, 39% coverage: 23:231/530 of query aligns to 25:232/615 of 5lilA
Sites not aligning to the query:
7roqA Alternative structure of human abca1
30% identity, 38% coverage: 18:219/530 of query aligns to 784:979/1831 of 7roqA
Sites not aligning to the query:
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
31% identity, 39% coverage: 23:231/530 of query aligns to 25:232/592 of 5lj7A
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
31% identity, 40% coverage: 6:219/530 of query aligns to 7:221/375 of 2d62A
2pmkA Crystal structures of an isolated abc-atpase in complex with tnp-adp (see paper)
34% identity, 38% coverage: 22:220/530 of query aligns to 22:218/243 of 2pmkA
Sites not aligning to the query:
>RR42_RS30800 FitnessBrowser__Cup4G11:RR42_RS30800
MPTPILRLAGITKRFGPLVANDDISLELQRGEVLALLGENGAGKSTLVSILFGHYVADAG
TVEVDGQPLPPGQPRAALTAGIGMVHQHFTLADNLSVLDNIMLGTQPLWQWRLDGHAARG
KVLALAERFGLAVRPQARVGELSVGERQRVEIVKALYRGARVLILDEPTAVLTPHEAETL
FSTLAQLIAEGLSVIFISHKLDEVLRVSDRIAVLRGGKLVALCAAAQTTKAELAELMVGR
VVAMPERVARRSAEDGANGNAAPPVLALEHVGARAANGRALLREVSLQVRAGEIVGIAGV
SGNGQAALAELASGMLEASEGRITLAGKPMSAKPRAWIGAGVARVPEDRHAIGVVGDLAV
WENAVSEQLSEPRFSRWGVIRRAAAQRFARDLVARFDVRTAGIDVPARTMSGGNMQKLIL
GRALSVRGEGSAPRLVVASQPTWGLDIGAVAYVRARLLDAAREGAAVLLISEDLDELHAL
ADRIAVMHAGHLTEARPTAAWTLGELGLAMAGSGGGQHAQAGKGEVLHAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory