Comparing RR42_RS31070 FitnessBrowser__Cup4G11:RR42_RS31070 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
8ej0A Crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mg
49% identity, 96% coverage: 24:576/576 of query aligns to 16:567/568 of 8ej0A
8epzA Crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mn
49% identity, 96% coverage: 24:576/576 of query aligns to 17:568/569 of 8epzA
B5ZZ34 L-arabinonate dehydratase; ArDHT; D-fuconate dehydratase; Galactonate dehydratase; L-arabonate dehydratase; EC 4.2.1.25; EC 4.2.1.67; EC 4.2.1.6 from Rhizobium leguminosarum bv. trifolii (strain WSM2304) (see 2 papers)
48% identity, 96% coverage: 16:567/576 of query aligns to 17:570/579 of B5ZZ34
5j85A Ser480ala mutant of l-arabinonate dehydratase (see paper)
48% identity, 96% coverage: 16:567/576 of query aligns to 14:567/576 of 5j85A
Q1JUQ1 L-arabonate dehydratase; L-arabinonate dehydratase; EC 4.2.1.25 from Azospirillum brasilense (see paper)
49% identity, 97% coverage: 16:576/576 of query aligns to 14:582/583 of Q1JUQ1
7m3kA Crystal structure of galactonate dehydratase from brucella melitensis biovar abortus 2308
38% identity, 93% coverage: 22:557/576 of query aligns to 18:568/587 of 7m3kA
5oynA Crystal structure of d-xylonate dehydratase in holo-form (see paper)
37% identity, 94% coverage: 22:562/576 of query aligns to 23:573/589 of 5oynA
Q9A9Z2 D-xylonate dehydratase; XyDHT; Gluconate dehydratase; EC 4.2.1.82; EC 4.2.1.39 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see 2 papers)
37% identity, 94% coverage: 22:562/576 of query aligns to 29:579/595 of Q9A9Z2
6ovtA Crystal structure of ilvd from mycobacterium tuberculosis (see paper)
37% identity, 92% coverage: 27:557/576 of query aligns to 21:558/562 of 6ovtA
P9WKJ5 Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 92% coverage: 27:557/576 of query aligns to 34:571/575 of P9WKJ5
Q9LIR4 Dihydroxy-acid dehydratase, chloroplastic; AthDHAD; DAD; EC 4.2.1.9 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 93% coverage: 27:561/576 of query aligns to 70:607/608 of Q9LIR4
8hs0A The mutant structure of dhad v178w
33% identity, 93% coverage: 27:561/576 of query aligns to 32:569/570 of 8hs0A
8imuA Dihydroxyacid dehydratase (dhad) mutant-v497f
31% identity, 93% coverage: 27:561/576 of query aligns to 29:522/523 of 8imuA
>RR42_RS31070 FitnessBrowser__Cup4G11:RR42_RS31070
PAQDAENGLGKGLTNYGDKGFSLFLRKAFIKGAGYTDDALSRPVIGIVNTNSSYNPCHGN
APQLVEAVKRGVMLAGGLPVDFPTISVHESFSAPTSMYLRNLMSMDTEEMIRAQPMDAVV
LIGGCDKTVPAQLMGAASAGVPAIQLVTGSMLTGSHRGERVGACTDCRRYWGRYRAEEID
APEIADVNNQLVASVGTCSVMGTASTMACLTEALGMMVAGGASAPAVTADRVRVAERTGT
TAVAMARSGLTPERILTGRAIENAIRVLLAIGGSTNGIVHLTAIAGRLGIGIDLAGLDRM
SRETPVLVDLKPSGQHYMEDFHAAGGMPALLRELRPLLHLDTLTVSGRTLGEELDAAPAP
FAQEVIRPFDAPIYPVGGLAVLRGNLAPGGAIIKQSAADPVLMEHEGRAVVFEDAEDMAL
RIDDDALDVKADDILVLKRIGPTGAPGMPEAGYMPIPRKLARAGVKDMVRISDGRMSGTA
AGTIVLHVTPEAAIGGPLAHVRNGDRIRLSVARREISLLIDDAELARRAAEHEVVRPAAE
RGYRKLFLATVTQADQGVDFDFLRAARTSETVPRKS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory