SitesBLAST
Comparing RR42_RS31270 FitnessBrowser__Cup4G11:RR42_RS31270 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
5ti1H Crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400
65% identity, 99% coverage: 5:420/420 of query aligns to 13:429/430 of 5ti1H
- active site: D139 (= D130), H146 (= H137), E212 (= E203), E214 (= E205), D246 (= D237), R250 (= R241), Q253 (= Q244), K266 (= K257), T270 (= T261), E377 (= E368)
- binding magnesium ion: D139 (= D130), E212 (= E203), E214 (= E205), D246 (= D237)
1hyoB Crystal structure of fumarylacetoacetate hydrolase complexed with 4- (hydroxymethylphosphinoyl)-3-oxo-butanoic acid (see paper)
58% identity, 99% coverage: 7:420/420 of query aligns to 4:418/419 of 1hyoB
- active site: D128 (= D130), H135 (= H137), E201 (= E203), E203 (= E205), D235 (= D237), R239 (= R241), Q242 (= Q244), K255 (= K257), T259 (= T261), E366 (= E368)
- binding acetate ion: Y130 (= Y132), V139 (= V141), R144 (= R146)
- binding calcium ion: D128 (= D130), E201 (= E203), E203 (= E205), D235 (= D237)
- binding 4-[hydroxy-[methyl-phosphinoyl]]-3-oxo-butanoic acid: D128 (= D130), F129 (= F131), Y130 (= Y132), H135 (= H137), Y161 (= Y163), K255 (= K257), G351 (= G353), T352 (= T354)
- binding magnesium ion: D235 (= D237), W236 (= W238), K255 (= K257), G258 (= G260), T259 (= T261)
2hzyA Mouse fumarylacetoacetate hydrolase complexes with a transition-state mimic of the complete substrate (see paper)
58% identity, 99% coverage: 7:420/420 of query aligns to 2:416/416 of 2hzyA
- active site: D126 (= D130), H133 (= H137), E199 (= E203), E201 (= E205), D233 (= D237), R237 (= R241), Q240 (= Q244), K253 (= K257), T257 (= T261), E364 (= E368)
- binding calcium ion: G122 (≠ P126), D123 (≠ G127)
- binding manganese (ii) ion: D126 (= D130), E199 (= E203), E201 (= E205), D233 (= D237)
1qcoA Crystal structure of fumarylacetoacetate hydrolase complexed with fumarate and acetoacetate (see paper)
58% identity, 99% coverage: 7:420/420 of query aligns to 2:416/416 of 1qcoA
- active site: K253 (= K257)
- binding acetoacetic acid: D126 (= D130), F127 (= F131), Y128 (= Y132), H133 (= H137), Y159 (= Y163), E199 (= E203), K253 (= K257), G349 (= G353), T350 (= T354)
- binding calcium ion: D126 (= D130), E199 (= E203), E201 (= E205), D233 (= D237)
- binding fumaric acid: Y128 (= Y132), V137 (= V141), R142 (= R146), Q240 (= Q244), Y244 (= Y248)
P35505 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Mus musculus (Mouse) (see 3 papers)
58% identity, 99% coverage: 7:420/420 of query aligns to 2:416/419 of P35505
- D126 (= D130) binding
- E199 (= E203) binding
- E201 (= E205) binding ; mutation to G: Decrease in activity.
- D233 (= D237) binding ; binding
- K253 (= K257) binding
- T257 (= T261) binding
P16930 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Homo sapiens (Human) (see 14 papers)
57% identity, 99% coverage: 7:420/420 of query aligns to 2:416/419 of P16930
- S2 (= S7) modified: N-acetylserine
- N16 (= N23) to I: in TYRSN1; loss of activity; dbSNP:rs121965073
- A35 (= A41) to T: in TYRSN1; atypical mild phenotype
- F62 (= F66) to C: in TYRSN1; loss of activity
- A134 (= A138) to D: in TYRSN1; loss of activity; dbSNP:rs121965074
- C193 (= C197) to R: in TYRSN1; loss of activity
- D233 (= D237) to V: in TYRSN1; loss of activity; dbSNP:rs80338897
- W234 (= W238) to G: in TYRSN1; loss of activity; dbSNP:rs1555441595
- Q279 (= Q283) to R: in TYRSN1; may affect splicing resulting in skipping of exon 8 alone or together with exon 9; lower activity as compared to wild type; dbSNP:rs121965078
- R341 (= R345) to W: does not cause a clinically relevant phenotype; results in lower enzyme activity; dbSNP:rs11555096
- P342 (≠ V346) to L: in TYRSN1; loss of activity; dbSNP:rs779040832
- R381 (= R385) to G: in TYRSN1; loss of activity; dbSNP:rs121965077
- F405 (= F409) to H: in TYRSN1; requires 2 nucleotide substitutions
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
39% identity, 19% coverage: 197:275/420 of query aligns to 117:191/277 of 6iymA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
33% identity, 22% coverage: 179:269/420 of query aligns to 81:167/252 of 3qdfA
Sites not aligning to the query:
Query Sequence
>RR42_RS31270 FitnessBrowser__Cup4G11:RR42_RS31270
MTTVQQSWIESANDGVTHFPLQNLPYGIFSPNGQGPRVGVAIGDFILDLSVLDEAGLLPA
CVKGVFGGATLNAFIALGKPAWTETRQRLTSMLAADDTTLHPKSALHEQALVPMAWATLH
LPVDIPGYTDFYSSREHATNVGRMFRDPDNALLPNWLEIPIGYNGRASSVVVSGTELRRP
KGQIKPPNAPRPVFTACQKLDYELEMAFIVGKPSTLGEPVSTAAAAGHMFGMVILNDWSA
RDIQQWEYVPLGPFNSKGFGTSISPWVVTMDALEPFRRDNPVQSPEPLAYLQQPERNAYD
IALEVSLRPEGAAQATTVCRTNFKAMYWTMVQQLAHHTVSGCNVRVGDLMGSGTISGTTP
DSYGSLLELTRNGAEPLTLADGSKRGFLEDGDEVVMAGWCQGDGYRVGFGEVAGKILPAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory