SitesBLAST
Comparing RR42_RS31610 FitnessBrowser__Cup4G11:RR42_RS31610 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8u99A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-serine adduct)
41% identity, 97% coverage: 4:391/402 of query aligns to 1:391/391 of 8u99A
- binding pyridoxal-5'-phosphate: C81 (≠ S87), G82 (= G88), A83 (≠ L89), Y107 (= Y113), D181 (= D184), T205 (= T208), K206 (= K209), M215 (= M218), W336 (= W339)
- binding serine: Y107 (= Y113), K206 (= K209), Y334 (≠ A337), S335 (= S338), W336 (= W339), R368 (= R368)
8u98A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-glycine adduct)
41% identity, 97% coverage: 4:391/402 of query aligns to 1:391/391 of 8u98A
- binding glycine: Y107 (= Y113), K206 (= K209), Y334 (≠ A337), S335 (= S338), W336 (= W339), R368 (= R368)
- binding pyridoxal-5'-phosphate: Y52 (= Y58), R54 (= R60), C81 (≠ S87), G82 (= G88), A83 (≠ L89), Y107 (= Y113), D181 (= D184), A203 (= A206), T205 (= T208), K206 (= K209), M215 (= M218), W336 (= W339)
8sabA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp adduct with alanine (c2 form)
41% identity, 97% coverage: 4:391/402 of query aligns to 2:392/392 of 8sabA
- binding lysine: N9 (≠ H11), R12 (≠ T14), R13 (vs. gap), K14 (≠ P15), T17 (≠ V18), L330 (= L332), E341 (= E343)
- binding pyridoxal-5'-phosphate: C82 (≠ S87), G83 (= G88), A84 (≠ L89), Y108 (= Y113), D182 (= D184), A204 (= A206), T206 (= T208), K207 (= K209), M216 (= M218), W337 (= W339)
- binding alanyl-pyridoxal-5'-phosphate: C82 (≠ S87), G83 (= G88), A84 (≠ L89), Y108 (= Y113), D182 (= D184), A204 (= A206), T206 (= T208), K207 (= K209), M216 (= M218), Y335 (≠ A337), S336 (= S338), W337 (= W339), R369 (= R368)
8sa9A Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp-oxamate adduct (c2 form)
41% identity, 97% coverage: 4:391/402 of query aligns to 1:391/391 of 8sa9A
- binding pyridoxal-5'-phosphate: C81 (≠ S87), G82 (= G88), A83 (≠ L89), Y107 (= Y113), D181 (= D184), A203 (= A206), T205 (= T208), K206 (= K209), M215 (= M218), W336 (= W339)
- binding [({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino](oxo)acetic acid: C81 (≠ S87), G82 (= G88), A83 (≠ L89), Y107 (= Y113), D181 (= D184), A203 (= A206), T205 (= T208), K206 (= K209), M215 (= M218), S335 (= S338), W336 (= W339), R368 (= R368)
8sadA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp/malonate complex (c2 form)
41% identity, 97% coverage: 4:391/402 of query aligns to 8:398/398 of 8sadA
- binding magnesium ion: A359 (= A355), R362 (vs. gap), A365 (≠ S358)
- binding pyridoxal-5'-phosphate: C88 (≠ S87), G89 (= G88), A90 (≠ L89), Y114 (= Y113), D188 (= D184), A210 (= A206), T212 (= T208), K213 (= K209), M222 (= M218), W343 (= W339)
P06721 Cystathionine beta-lyase MetC; CBL; CL; Beta-cystathionase MetC; Cysteine desulfhydrase MetC; CD; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13; EC 4.4.1.28 from Escherichia coli (strain K12) (see 2 papers)
40% identity, 96% coverage: 6:391/402 of query aligns to 7:395/395 of P06721
- K210 (= K209) modified: N6-(pyridoxal phosphate)lysine
2gqnA Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-nitro-benzamide (see paper)
40% identity, 96% coverage: 6:391/402 of query aligns to 3:391/391 of 2gqnA
- active site: R54 (= R60), Y107 (= Y113), D181 (= D184), K206 (= K209)
- binding (5-hydroxy-6-methyl-4-((2-(2-(2-nitrobenzamido)acetyl)hydrazinyl)methyl)pyridin-3-yl)methyl dihydrogen phosphate: C81 (≠ S87), G82 (= G88), A83 (≠ L89), Y107 (= Y113), E108 (≠ A114), D181 (= D184), A203 (= A206), T205 (= T208), K206 (= K209), M215 (= M218), Y334 (≠ A337), S335 (= S338), W336 (= W339), R368 (= R368)
2fq6A Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-trifluoromethyl-benzamide (see paper)
40% identity, 96% coverage: 6:391/402 of query aligns to 3:391/391 of 2fq6A
- active site: R54 (= R60), Y107 (= Y113), D181 (= D184), K206 (= K209)
- binding phosphoric acid mono-(5-hydroxy-6-methyl-4-{[2-(2-trifluoromethyl-benzoylamino)-acetyl]-hydrazonomethyl}-pyridin-3-ylmethyl)ester: C81 (≠ S87), G82 (= G88), A83 (≠ L89), Y107 (= Y113), P109 (= P115), D181 (= D184), A203 (= A206), T205 (= T208), K206 (= K209), M215 (= M218), Y334 (≠ A337), S335 (= S338), W336 (= W339), R368 (= R368)
1cl2A Cystathionine beta-lyase (cbl) from escherichia coli in complex with aminoethoxyvinylglycine (see paper)
40% identity, 96% coverage: 6:391/402 of query aligns to 3:391/391 of 1cl2A
- active site: R54 (= R60), Y107 (= Y113), D181 (= D184), K206 (= K209)
- binding (2E,3E)-4-(2-aminoethoxy)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: C81 (≠ S87), G82 (= G88), A83 (≠ L89), Y107 (= Y113), D181 (= D184), A203 (= A206), T205 (= T208), K206 (= K209), M215 (= M218), Y334 (≠ A337), S335 (= S338), W336 (= W339), R368 (= R368)
1cl1B Cystathionine beta-lyase (cbl) from escherichia coli (see paper)
40% identity, 96% coverage: 6:391/402 of query aligns to 4:392/392 of 1cl1B
4itxA P113s mutant of e. Coli cystathionine beta-lyase metc inhibited by reaction with l-ala-p (see paper)
40% identity, 96% coverage: 6:391/402 of query aligns to 3:391/391 of 4itxA
- active site: R54 (= R60), Y107 (= Y113), D181 (= D184), K206 (= K209)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: C81 (≠ S87), G82 (= G88), A83 (≠ L89), Y107 (= Y113), D181 (= D184), A203 (= A206), T205 (= T208), K206 (= K209), M215 (= M218), Y334 (≠ A337), S335 (= S338), W336 (= W339), R368 (= R368)
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
39% identity, 95% coverage: 7:388/402 of query aligns to 5:371/373 of 4l0oH
- active site: R40 (= R60), Y92 (= Y113), D164 (= D184), K189 (= K209)
- binding pyridoxal-5'-phosphate: Y38 (= Y58), R40 (= R60), S67 (= S87), G68 (= G88), L69 (= L89), Y92 (= Y113), D164 (= D184), S186 (≠ A206), T188 (= T208), K189 (= K209)
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
35% identity, 94% coverage: 6:383/402 of query aligns to 9:388/396 of 4omaA
- active site: R59 (= R60), Y112 (= Y113), D184 (= D184), K209 (= K209)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G87 (= G88), I88 (≠ L89), Y112 (= Y113), D184 (= D184), S206 (≠ A206), T208 (= T208), K209 (= K209), V337 (≠ A337), S338 (= S338), R373 (= R368)
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
35% identity, 94% coverage: 6:383/402 of query aligns to 9:388/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
35% identity, 94% coverage: 6:383/402 of query aligns to 9:388/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
35% identity, 94% coverage: 6:383/402 of query aligns to 9:388/396 of 3jw9A
8j6nA Crystal structure of cystathionine gamma-lyase in complex with compound 1 (see paper)
34% identity, 96% coverage: 3:389/402 of query aligns to 7:387/390 of 8j6nA
- binding [6-methyl-4-[(~{E})-(oxamoylhydrazinylidene)methyl]-5-oxidanyl-pyridin-3-yl]methyl dihydrogen phosphate: Y51 (= Y58), R53 (= R60), G81 (= G88), L82 (= L89), Y105 (= Y113), E148 (= E155), N152 (≠ S159), D178 (= D184), S200 (≠ A206), T202 (= T208), K203 (= K209), E330 (≠ A337), S331 (= S338), T346 (vs. gap), R366 (= R368)
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
35% identity, 95% coverage: 6:387/402 of query aligns to 8:391/395 of 5m3zA
- active site: R58 (= R60), Y111 (= Y113), D183 (= D184), K208 (= K209)
- binding norleucine: Y111 (= Y113), H113 (≠ P115), K208 (= K209), V336 (≠ A337), S337 (= S338)
- binding pyridoxal-5'-phosphate: G86 (= G88), I87 (≠ L89), Y111 (= Y113), E154 (= E155), D183 (= D184), T185 (= T186), S205 (≠ A206), T207 (= T208), K208 (= K209)
- binding 2-[o-phosphonopyridoxyl]-amino-hexanoic acid: G86 (= G88), I87 (≠ L89), Y111 (= Y113), D183 (= D184), S205 (≠ A206), T207 (= T208), K208 (= K209), V336 (≠ A337), S337 (= S338), R372 (= R368)
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
35% identity, 95% coverage: 6:387/402 of query aligns to 9:392/396 of 6egrA
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
35% identity, 95% coverage: 6:387/402 of query aligns to 9:392/396 of 4hf8A
- active site: R59 (= R60), Y112 (= Y113), D184 (= D184), K209 (= K209)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: G87 (= G88), I88 (≠ L89), Y112 (= Y113), E155 (= E155), N159 (≠ S159), D184 (= D184), S206 (≠ A206), K209 (= K209), S338 (= S338), R373 (= R368)
Query Sequence
>RR42_RS31610 FitnessBrowser__Cup4G11:RR42_RS31610
MSHHRDTQLIHAGTPPFVQGHGPVNVPVVRTSTVRFENSDAYDDIRARHARGERVSSYGR
HGMDTHRALEDAIAGLEGGNRAFLAPSGLAAISLTFLALLSPGDHALVVDSVYAPVRRLE
QTLLRRLGIEVSYFSPSQDDLDALIRPNTRLLYLESPSSLLYEVLDLPRLVQIAHRHGVV
VATDNTWASGHALQPLALGVDISILASTKYISGHSDLMQGAVVVKDEALARRIADAHDGF
GLAISADDAYLALRGIRTLAVRLAQHQRNALAVAQFLEAHEAVGRVFYPALPSDPGHALW
LRDFSGANGLVSFSLPTADVAAARKLVDSLSLFGLGASWGGYESLVQVAAPERLAEHSYW
RGAEPVIRLHIGLEAPEDLIADLAQGLAATVQASVPQRRAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory