SitesBLAST
Comparing RR42_RS31670 FitnessBrowser__Cup4G11:RR42_RS31670 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
39% identity, 96% coverage: 9:252/254 of query aligns to 4:243/244 of 4nbuB
- active site: G18 (= G23), N111 (= N117), S139 (= S145), Q149 (≠ N156), Y152 (= Y159), K156 (= K163)
- binding acetoacetyl-coenzyme a: D93 (≠ R99), K98 (≠ D104), S139 (= S145), N146 (≠ G152), V147 (≠ Y154), Q149 (≠ N156), Y152 (= Y159), F184 (≠ I191), M189 (= M196), K200 (= K209)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G19), N17 (≠ S22), G18 (= G23), I19 (= I24), D38 (= D43), F39 (≠ T44), V59 (≠ A65), D60 (= D66), V61 (= V67), N87 (= N93), A88 (= A94), G89 (= G95), I90 (≠ V96), T137 (= T143), S139 (= S145), Y152 (= Y159), K156 (= K163), P182 (= P189), F184 (≠ I191), T185 (≠ I192), T187 (= T194), M189 (= M196)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
37% identity, 97% coverage: 8:254/254 of query aligns to 3:255/255 of 5itvA
- active site: G18 (= G23), S141 (= S145), Y154 (= Y159), K158 (= K163)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G19), S17 (= S22), G18 (= G23), I19 (= I24), D38 (= D43), I39 (≠ T44), T61 (≠ A65), I63 (≠ V67), N89 (= N93), G91 (= G95), T139 (= T143), S141 (= S145), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (≠ S190), I186 (= I191), I187 (= I192)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
42% identity, 97% coverage: 8:254/254 of query aligns to 3:249/249 of 3uf0A
- active site: G18 (= G23), S141 (= S145), V151 (≠ I157), Y154 (= Y159), K158 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G19), S17 (= S22), G18 (= G23), I19 (= I24), R39 (vs. gap), D63 (= D66), L64 (≠ V67), N89 (= N93), G91 (= G95), I92 (≠ V96), I139 (≠ T143), A140 (= A144), S141 (= S145), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (≠ S190), V187 (≠ I192), T189 (= T194), N191 (≠ M196), T192 (= T197)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
37% identity, 96% coverage: 9:251/254 of query aligns to 7:250/258 of 4wecA
- active site: G21 (= G23), S143 (= S145), Q154 (≠ N156), Y157 (= Y159), K161 (= K163)
- binding nicotinamide-adenine-dinucleotide: G17 (= G19), A19 (≠ G21), S20 (= S22), G21 (= G23), I22 (= I24), D41 (= D43), I42 (≠ T44), V61 (≠ A65), D62 (= D66), V63 (= V67), N89 (= N93), T141 (= T143), Y157 (= Y159), K161 (= K163), P187 (= P189), P189 (≠ I191), V190 (≠ I192)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
37% identity, 96% coverage: 8:250/254 of query aligns to 2:248/252 of 1vl8B
- active site: G17 (= G23), S143 (= S145), I154 (= I157), Y157 (= Y159), K161 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G19), R16 (≠ S22), G17 (= G23), L18 (≠ I24), S37 (vs. gap), R38 (vs. gap), C63 (≠ A65), D64 (= D66), V65 (= V67), A91 (≠ N93), A92 (= A94), G93 (= G95), I94 (≠ V96), V114 (= V116), I141 (≠ T143), S143 (= S145), Y157 (= Y159), K161 (= K163), P187 (= P189), G188 (≠ S190), Y190 (≠ I192), T192 (= T194), M194 (= M196), T195 (= T197)
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
40% identity, 96% coverage: 8:250/254 of query aligns to 7:250/254 of 3lqfA
- active site: G22 (= G23), S144 (= S145), Y159 (= Y159), K163 (= K163)
- binding meso-erythritol: N151 (≠ G152), Y159 (= Y159), Y191 (≠ I191), T197 (= T197), M200 (≠ L200)
- binding nicotinamide-adenine-dinucleotide: G18 (= G19), S21 (= S22), G22 (= G23), I23 (= I24), D42 (= D43), R43 (≠ T44), D66 (= D66), V67 (= V67), S92 (≠ N93), L142 (≠ T143), S144 (= S145), K163 (= K163), P189 (= P189), V192 (≠ I192), T194 (= T194), M196 (= M196), T197 (= T197)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
40% identity, 96% coverage: 8:250/254 of query aligns to 7:250/254 of 2wsbA
- active site: G22 (= G23), S144 (= S145), Y159 (= Y159), K163 (= K163)
- binding nicotinamide-adenine-dinucleotide: G18 (= G19), S21 (= S22), G22 (= G23), I23 (= I24), D42 (= D43), R43 (≠ T44), D66 (= D66), V67 (= V67), S92 (≠ N93), A93 (= A94), L142 (≠ T143), S144 (= S145), Y159 (= Y159), K163 (= K163), P189 (= P189), V192 (≠ I192), T194 (= T194), M196 (= M196), T197 (= T197)
- binding n-propanol: S144 (= S145), M145 (≠ I146), N151 (≠ G152), N151 (≠ G152), Y159 (= Y159), Y159 (= Y159), Y191 (≠ I191)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
40% identity, 96% coverage: 8:250/254 of query aligns to 7:250/254 of 2wdzA
- active site: G22 (= G23), S144 (= S145), Y159 (= Y159), K163 (= K163)
- binding (2S)-pentane-1,2-diol: A45 (≠ G46), D49 (≠ E50), R62 (≠ H62), S146 (≠ L147), Y159 (= Y159)
- binding nicotinamide-adenine-dinucleotide: G18 (= G19), S21 (= S22), G22 (= G23), I23 (= I24), D42 (= D43), R43 (≠ T44), A65 (= A65), D66 (= D66), V67 (= V67), S92 (≠ N93), A93 (= A94), L142 (≠ T143), S144 (= S145), Y159 (= Y159), K163 (= K163), P189 (= P189), V192 (≠ I192), T194 (= T194), M196 (= M196), T197 (= T197)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
40% identity, 96% coverage: 8:250/254 of query aligns to 7:250/254 of C0KTJ6
Sites not aligning to the query:
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
38% identity, 97% coverage: 8:254/254 of query aligns to 1:244/251 of H9XP47
- N15 (≠ S22) binding
- M17 (≠ I24) binding
- D36 (= D43) binding
- D60 (= D66) binding
- V61 (= V67) binding
- N87 (= N93) binding
- S138 (= S145) binding ; binding
- V139 (≠ I146) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ L147) binding
- Y151 (= Y159) binding ; binding ; binding
- K155 (= K163) binding
- V184 (≠ I192) binding
- T186 (= T194) binding
- RDK 197:199 (≠ VAK 207:209) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
39% identity, 97% coverage: 9:254/254 of query aligns to 2:244/251 of 6vspA
- active site: G16 (= G23), S138 (= S145), Y151 (= Y159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), N15 (≠ S22), G16 (= G23), M17 (≠ I24), D36 (= D43), W37 (≠ T44), W37 (≠ T44), A38 (≠ N45), I59 (≠ A63), D60 (= D66), V61 (= V67), N87 (= N93), A88 (= A94), G89 (= G95), V90 (= V96), V110 (= V116), T136 (= T143), S138 (= S145), Y151 (= Y159), K155 (= K163), P181 (= P189), S182 (= S190), L183 (≠ I191), V184 (≠ I192), T186 (= T194), N187 (≠ P195), M188 (= M196), T189 (= T197)
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
39% identity, 97% coverage: 9:254/254 of query aligns to 2:244/251 of 6xewA
- active site: G16 (= G23), S138 (= S145), Y151 (= Y159)
- binding r,3-hydroxybutan-2-one: S138 (= S145), S140 (≠ L147), Y151 (= Y159)
- binding s,3-hydroxybutan-2-one: S138 (= S145), Y151 (= Y159), S182 (= S190)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), N15 (≠ S22), G16 (= G23), M17 (≠ I24), D36 (= D43), W37 (≠ T44), W37 (≠ T44), A38 (≠ N45), I59 (≠ A63), D60 (= D66), V61 (= V67), N87 (= N93), A88 (= A94), G89 (= G95), V110 (= V116), T136 (= T143), S138 (= S145), Y151 (= Y159), K155 (= K163), S182 (= S190), L183 (≠ I191), V184 (≠ I192), T186 (= T194), N187 (≠ P195), M188 (= M196), T189 (= T197)
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
39% identity, 97% coverage: 9:254/254 of query aligns to 4:246/252 of 6vspB
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
38% identity, 99% coverage: 1:251/254 of query aligns to 5:257/261 of 5u9pB
- active site: G27 (= G23), S152 (= S145), Y165 (= Y159), K169 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G19), R26 (≠ S22), G27 (= G23), I28 (= I24), R48 (≠ T44), D73 (= D66), V74 (= V67), N100 (= N93), A101 (= A94), I150 (≠ T143), Y165 (= Y159), K169 (= K163), P195 (= P189), F198 (≠ I192), T200 (= T194), L202 (≠ M196), N203 (≠ T197)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
37% identity, 96% coverage: 10:253/254 of query aligns to 3:247/248 of 6ixmC
- active site: G16 (= G23), S142 (= S145), Y155 (= Y159), K159 (= K163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), S15 (= S22), G16 (= G23), I17 (= I24), D36 (= D43), I37 (≠ T44), A61 (= A65), D62 (= D66), T63 (≠ V67), N89 (= N93), A90 (= A94), M140 (≠ T143), S142 (= S145), Y155 (= Y159), K159 (= K163), P185 (= P189), A186 (≠ S190), Y187 (≠ I191), I188 (= I192), L192 (≠ M196)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
41% identity, 96% coverage: 10:253/254 of query aligns to 3:238/240 of 2d1yA
- active site: G16 (= G23), S135 (= S145), N145 (= N156), Y148 (= Y159), K152 (= K163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), R15 (≠ S22), I17 (= I24), D36 (= D43), L37 (≠ T44), R38 (≠ N45), V55 (= V67), D56 (≠ S68), L57 (≠ N69), N83 (= N93), A84 (= A94), A85 (≠ G95), I86 (≠ V96), V133 (≠ T143), S135 (= S145), Y148 (= Y159), K152 (= K163), P178 (= P189), G179 (≠ S190), I181 (= I192), T183 (= T194), A185 (≠ M196), V186 (≠ T197)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
37% identity, 97% coverage: 8:254/254 of query aligns to 3:227/227 of 5itvD
- active site: G18 (= G23), S141 (= S145), Y154 (= Y159), K158 (= K163)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G19), S17 (= S22), G18 (= G23), I19 (= I24), D38 (= D43), I39 (≠ T44), T61 (≠ A65), D62 (= D66), I63 (≠ V67), N89 (= N93), T139 (= T143), S141 (= S145), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (≠ S190), I187 (= I192)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
37% identity, 96% coverage: 6:250/254 of query aligns to 7:262/267 of Q9LBG2
- 17:42 (vs. 16:41, 46% identical) binding
- E103 (≠ N97) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
39% identity, 95% coverage: 10:250/254 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G19), M16 (≠ I24), D35 (= D43), I36 (≠ T44), I62 (≠ V67), N88 (= N93), G90 (= G95), I138 (≠ T143), S140 (= S145), Y152 (= Y159), K156 (= K163), I185 (= I192)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 96% coverage: 10:252/254 of query aligns to 3:246/247 of 4jroC
- active site: G16 (= G23), S142 (= S145), Q152 (≠ N156), Y155 (= Y159), K159 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G19), S14 (≠ G21), R15 (≠ S22), G16 (= G23), I17 (= I24), N35 (≠ D43), Y36 (≠ T44), N37 (= N45), G38 (= G46), S39 (≠ A47), N63 (≠ D66), V64 (= V67), N90 (= N93), A91 (= A94), I93 (≠ V96), I113 (≠ V116), S142 (= S145), Y155 (= Y159), K159 (= K163), P185 (= P189), I188 (= I192), T190 (= T194)
Query Sequence
>RR42_RS31670 FitnessBrowser__Cup4G11:RR42_RS31670
MPHPFPDFRLTGQVTVVTGGGSGIGKALAHTFAGAGARVVVLDTNGAAAEQVANEIGSMA
QHAVADVSNEDAIESVMEDVARQHGRIDVLFNNAGVNRRNTSFDLTIADWNAVVAVNMTG
MFLCARAAARHMRDGGGGRIVNTASILGISGGWYPNIVYQATKGAVVNMTRSWAVEWAPY
NIRVNAVAPSIIRTPMTEALTSQPDVVAKFEALTPLGRLCEPADMTGPVLFLATAASSMV
TGHILPVDGGVLAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory