Comparing RR42_RS31745 FitnessBrowser__Cup4G11:RR42_RS31745 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
44% identity, 87% coverage: 30:245/249 of query aligns to 6:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
44% identity, 87% coverage: 30:245/249 of query aligns to 6:226/226 of 4zv1A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
45% identity, 86% coverage: 30:244/249 of query aligns to 12:228/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
39% identity, 87% coverage: 30:245/249 of query aligns to 12:228/229 of 6svfA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
36% identity, 88% coverage: 30:249/249 of query aligns to 5:226/226 of 8eyzA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
36% identity, 85% coverage: 32:243/249 of query aligns to 18:233/235 of 4g4pA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
38% identity, 87% coverage: 29:244/249 of query aligns to 2:222/224 of 4ymxA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
37% identity, 88% coverage: 32:249/249 of query aligns to 5:225/231 of 2q2cA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
37% identity, 88% coverage: 32:249/249 of query aligns to 9:229/235 of 2pvuA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
37% identity, 88% coverage: 32:249/249 of query aligns to 15:235/241 of 2q2aA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
33% identity, 86% coverage: 30:244/249 of query aligns to 8:227/228 of 2y7iA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
36% identity, 87% coverage: 30:245/249 of query aligns to 15:231/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
36% identity, 87% coverage: 30:245/249 of query aligns to 19:235/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
36% identity, 87% coverage: 30:245/249 of query aligns to 19:235/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
36% identity, 87% coverage: 30:245/249 of query aligns to 19:235/241 of 3vvdA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
30% identity, 90% coverage: 22:244/249 of query aligns to 9:234/243 of 5eyfB
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
32% identity, 85% coverage: 32:243/249 of query aligns to 20:235/239 of 4zefA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
30% identity, 86% coverage: 30:244/249 of query aligns to 6:226/234 of 3k4uE
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
29% identity, 86% coverage: 29:243/249 of query aligns to 7:225/230 of 4kqpA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
31% identity, 95% coverage: 8:244/249 of query aligns to 10:253/260 of P02911
>RR42_RS31745 FitnessBrowser__Cup4G11:RR42_RS31745
MNLRRKCLLIGLMGLSLAAGLARAQDNAVLRVATDATFPPMEFVENGKRTGFDVELVEAL
AKTMGKRVEWTDIDFKGLIPGLISRRFDMAVSGIYITEERRKVVDFTDPYYTGGLVALVK
SGNTAINTPADLNGKKVSVQVGTKSVNFLRENYPQVQRVEVEKNQEMFNLVEIGRADAAV
TGKPAAMQYVKARGGMRVVEKALTTEEYGMAVRKDTPELTRAVNAALTKLKADGTYAQLV
QKWFGAAHK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory