SitesBLAST
Comparing RR42_RS31785 FitnessBrowser__Cup4G11:RR42_RS31785 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3nt6A Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant (see paper)
30% identity, 34% coverage: 44:329/849 of query aligns to 48:362/565 of 3nt6A
- active site: N325 (≠ Y292)
- binding coenzyme a: A321 (≠ V288), N325 (≠ Y292), R329 (= R296)
- binding flavin-adenine dinucleotide: E80 (≠ R77), V81 (≠ A78), S112 (≠ A104), P113 (≠ T105), G114 (= G106), L133 (≠ Y125), R134 (= R126), F161 (≠ L151), G302 (= G275), D303 (≠ E276), P319 (vs. gap), L320 (= L287), A321 (≠ V288)
Sites not aligning to the query:
- active site: 11, 38, 42, 43, 471, 472
- binding coenzyme a: 11, 18, 19, 22, 39, 42, 43, 459, 462, 463, 466, 534, 535
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12, 33, 34, 42, 43
8a56B Coenzyme a-persulfide reductase (coapr) from enterococcus faecalis (see paper)
29% identity, 39% coverage: 2:329/849 of query aligns to 2:338/539 of 8a56B
- binding flavin-adenine dinucleotide: I6 (= I6), G7 (= G7), V9 (vs. gap), G11 (vs. gap), E32 (≠ C33), K33 (≠ E34), C42 (≠ V43), V80 (≠ A78), S109 (≠ A104), P110 (≠ T105), G111 (= G106), I159 (≠ L152), G278 (= G275), D279 (≠ E276), S295 (≠ G286), L296 (= L287), A297 (≠ V288)
- binding 3'-phosphate-adenosine-5'-diphosphate: T17 (≠ K14), R18 (≠ F15), R21 (≠ C18), F70 (≠ S68), R305 (= R296)
Sites not aligning to the query:
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
33% identity, 32% coverage: 61:329/849 of query aligns to 69:346/541 of 6pfzA
- binding calcium ion: D306 (≠ E293), T332 (≠ S315)
- binding coenzyme a: K76 (≠ S68), R313 (= R296)
- binding flavin-adenine dinucleotide: A86 (= A78), A115 (= A104), T116 (= T105), G117 (= G106), L136 (≠ Y125), G286 (= G275), D287 (≠ E276), P303 (= P290), F304 (≠ G291), G305 (≠ Y292)
Sites not aligning to the query:
- active site: 37, 42, 455, 456
- binding calcium ion: 427, 428
- binding coenzyme a: 14, 18, 21, 38, 40, 42, 430, 447, 512, 513, 516
- binding flavin-adenine dinucleotide: 7, 11, 32, 33, 41, 42
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
26% identity, 47% coverage: 1:396/849 of query aligns to 1:402/424 of 8c0zE
Q8U1K9 NAD(P)H:rubredoxin oxidoreductase; NROR; Rubredoxin--NAD(P)(+) reductase; EC 1.18.1.4 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
30% identity, 45% coverage: 1:384/849 of query aligns to 1:356/359 of Q8U1K9
3ictA Crystal structure of reduced bacillus anthracis coadr-rhd (see paper)
30% identity, 31% coverage: 66:329/849 of query aligns to 73:347/557 of 3ictA
- active site: N309 (≠ Y292)
- binding coenzyme a: N309 (≠ Y292), R313 (= R296)
- binding flavin-adenine dinucleotide: V85 (≠ A78), S116 (≠ A104), P117 (≠ T105), G118 (= G106), L138 (≠ Y125), G286 (= G275), D287 (≠ E276), P303 (≠ G286), L304 (= L287), A305 (≠ V288)
Sites not aligning to the query:
- active site: 15, 42, 46, 47, 430, 456, 457
- binding coenzyme a: 15, 18, 22, 23, 26, 43, 46, 47, 439, 451, 520, 521, 524
- binding flavin-adenine dinucleotide: 12, 14, 16, 37, 38, 46, 47
3icsB Crystal structure of partially reduced bacillus anthracis coadr-rhd (see paper)
30% identity, 31% coverage: 66:329/849 of query aligns to 70:344/554 of 3icsB
- active site: N306 (≠ Y292)
- binding adenosine-5'-diphosphate: G162 (= G150), I164 (≠ L152), E183 (= E171), M184 (≠ F172), P190 (≠ A178), I244 (≠ A236), G245 (= G237)
- binding coenzyme a: N306 (≠ Y292), R310 (= R296)
- binding flavin-adenine dinucleotide: V82 (≠ A78), S113 (≠ A104), P114 (≠ T105), G115 (= G106), L135 (≠ Y125), R136 (= R126), I164 (≠ L152), L252 (= L244), G283 (= G275), D284 (≠ E276), P300 (≠ G286), L301 (= L287), A302 (≠ V288), A305 (≠ G291)
Sites not aligning to the query:
- active site: 12, 39, 43, 44, 427, 453, 454
- binding coenzyme a: 12, 15, 16, 19, 20, 23, 40, 43, 44, 428, 436, 441, 444, 445, 448, 517, 518, 521
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 34, 35, 43, 44
2v3aA Crystal structure of rubredoxin reductase from pseudomonas aeruginosa. (see paper)
27% identity, 46% coverage: 3:389/849 of query aligns to 4:377/381 of 2v3aA
- active site: L11 (≠ M10), K42 (≠ R42), P43 (≠ V43), M290 (≠ Y292)
- binding flavin-adenine dinucleotide: I7 (= I6), G8 (= G7), T9 (≠ H8), G10 (= G9), A12 (≠ V11), T33 (≠ L32), A34 (≠ C33), D35 (≠ E34), K42 (≠ R42), P43 (≠ V43), R79 (= R77), V80 (≠ A78), A105 (= A104), W106 (≠ T105), G107 (= G106), I153 (≠ L152), F157 (≠ C156), D274 (≠ E276), L284 (≠ G286), Y285 (≠ L287), V286 (= V288), K317 (= K319)
Q9HTK9 Rubredoxin-NAD(+) reductase; RdxR; EC 1.18.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
28% identity, 37% coverage: 3:319/849 of query aligns to 7:320/384 of Q9HTK9
1xhcA Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001
31% identity, 39% coverage: 2:333/849 of query aligns to 2:317/346 of 1xhcA
- active site: P10 (≠ M10), K38 (≠ R42), P39 (≠ V43), F145 (≠ L151), E149 (= E155), M276 (≠ Y292)
- binding flavin-adenine dinucleotide: V6 (≠ I6), G7 (= G7), G9 (= G9), P10 (≠ M10), G11 (≠ V11), D29 (≠ C33), K30 (≠ E34), K38 (≠ R42), P39 (≠ V43), E74 (≠ R77), A75 (= A78), A100 (= A104), T101 (= T105), G102 (= G106), L119 (≠ Y125), R120 (= R126), F145 (≠ L151), I146 (≠ L152), E149 (= E155), G259 (= G275), D260 (≠ E276), G270 (= G286), T271 (≠ L287), A272 (≠ V288)
3kljA Crystal structure of nadh:rubredoxin oxidoreductase from clostridium acetobutylicum (see paper)
29% identity, 41% coverage: 2:350/849 of query aligns to 4:331/378 of 3kljA
- active site: P12 (≠ M10), R41 (= R42), P42 (≠ V43), N274 (≠ Y292)
- binding flavin-adenine dinucleotide: L8 (≠ I6), G9 (= G7), G11 (= G9), P12 (≠ M10), A13 (≠ V11), N32 (≠ C33), S33 (≠ E34), E34 (= E35), R41 (= R42), P42 (≠ V43), F77 (≠ R77), A78 (= A78), S105 (≠ T105), G106 (= G106), L123 (≠ Y125), Y124 (≠ R126), L150 (= L152), G257 (= G275), D258 (≠ E276), G268 (= G286), L269 (= L287), I270 (≠ V288), A273 (≠ G291), K301 (= K319)
Q9AL95 NADH-rubredoxin oxidoreductase; NROR; NADH:rubredoxin oxidoreductase; EC 1.18.1.1 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
29% identity, 41% coverage: 2:350/849 of query aligns to 5:332/379 of Q9AL95
- C26 (≠ Q25) modified: Disulfide link with 286
- NSE 33:35 (≠ CEE 33:35) binding
- R42 (= R42) binding
- A79 (= A78) binding
- Y125 (≠ R126) binding
- C137 (= C137) modified: Disulfide link with 216
- C216 (≠ M231) modified: Disulfide link with 137
- D259 (≠ E276) binding
- C286 (≠ L303) modified: Disulfide link with 26
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
29% identity, 36% coverage: 3:311/849 of query aligns to 4:316/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G7), G10 (= G9), H11 (≠ M10), A12 (≠ V11), D34 (≠ E34), E35 (= E35), R42 (= R42), P43 (≠ V43), S46 (= S46), K47 (≠ E47), R78 (= R77), M79 (≠ A78), T106 (= T105), R127 (= R126), I153 (≠ L152), D275 (≠ E276), S292 (≠ L287), V293 (= V288)
Sites not aligning to the query:
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
30% identity, 31% coverage: 65:329/849 of query aligns to 68:340/443 of 6rvhA
- active site: Y159 (≠ L151), E163 (= E155)
- binding coenzyme a: N303 (≠ A299), R307 (vs. gap)
- binding flavin-adenine dinucleotide: V81 (≠ A78), T113 (= T105), G114 (= G106), R134 (= R126), Y159 (≠ L151), G280 (= G275), D281 (≠ E276), P297 (≠ E293), L298 (≠ M294), G299 (≠ A295)
Sites not aligning to the query:
- active site: 39, 44, 53, 58, 425, 430
- binding coenzyme a: 20, 23, 40, 41, 44, 63, 359, 431, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 34, 35, 43, 44, 424, 425
- binding menadione: 364, 365, 430, 431
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
30% identity, 31% coverage: 65:329/849 of query aligns to 68:340/443 of 6rvbA
- active site: Y159 (≠ L151), E163 (= E155)
- binding coenzyme a: N303 (≠ A299), R307 (vs. gap)
- binding flavin-adenine dinucleotide: E80 (≠ R77), V81 (≠ A78), T113 (= T105), G114 (= G106), L133 (≠ Y125), R134 (= R126), I160 (≠ L152), G280 (= G275), D281 (≠ E276), L298 (≠ M294), G299 (≠ A295)
- binding nicotinamide-adenine-dinucleotide: G156 (= G148), G158 (= G150), Y159 (≠ L151), I160 (≠ L152), E179 (= E171), A180 (≠ F172), A240 (≠ S235), T241 (≠ A236), G242 (= G237), P297 (≠ E293), I328 (≠ K317), F329 (≠ L318)
Sites not aligning to the query:
- active site: 39, 44, 53, 58, 425, 430
- binding coenzyme a: 15, 20, 23, 40, 41, 44, 63, 359, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 36, 43, 44, 424, 425
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
30% identity, 31% coverage: 65:329/849 of query aligns to 68:340/443 of 6ruzA
- active site: Y159 (≠ L151), E163 (= E155)
- binding coenzyme a: N303 (≠ A299), R307 (vs. gap)
- binding flavin-adenine dinucleotide: E80 (≠ R77), V81 (≠ A78), T113 (= T105), G114 (= G106), A115 (≠ S107), L133 (≠ Y125), R134 (= R126), Y159 (≠ L151), G280 (= G275), D281 (≠ E276), P297 (≠ E293), L298 (≠ M294), G299 (≠ A295)
Sites not aligning to the query:
- active site: 39, 44, 53, 58, 425, 430
- binding coenzyme a: 15, 19, 20, 23, 40, 41, 44, 63, 359, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 43, 44, 424, 425
8pxkA Structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a (see paper)
33% identity, 32% coverage: 3:277/849 of query aligns to 7:271/403 of 8pxkA
- binding flavin-adenine dinucleotide: G13 (= G9), A15 (≠ V11), D37 (≠ E34), E38 (= E35), R45 (= R42), P46 (≠ V43), K50 (vs. gap), A79 (= A76), T106 (= T105), G107 (= G106), R127 (= R126), I153 (≠ L152), G269 (= G275), D270 (≠ E276)
Sites not aligning to the query:
2gr2A Crystal structure of ferredoxin reductase, bpha4 (oxidized form)
33% identity, 32% coverage: 3:277/849 of query aligns to 5:269/401 of 2gr2A
- active site: L12 (≠ M10), R43 (= R42), P44 (≠ V43)
- binding adenosine-5-diphosphoribose: R109 (≠ F110), V146 (≠ I147), G147 (= G148), G149 (= G150), V150 (≠ L151), I151 (≠ L152), E170 (= E171), T171 (≠ F172), R178 (≠ V179), G229 (≠ S235), I230 (≠ A236), G231 (= G237)
- binding flavin-adenine dinucleotide: G11 (= G9), A13 (≠ V11), D35 (≠ E34), E36 (= E35), R43 (= R42), P44 (≠ V43), K48 (vs. gap), A77 (= A76), T104 (= T105), G105 (= G106), R125 (= R126), G267 (= G275), D268 (≠ E276)
Sites not aligning to the query:
2gr0A Crystal structure of ferredoxin reductase, bpha4 (oxidized form, NAD+ complex) (see paper)
33% identity, 32% coverage: 3:277/849 of query aligns to 5:269/401 of 2gr0A
- active site: L12 (≠ M10), R43 (= R42), P44 (≠ V43)
- binding adenosine-5'-diphosphate: V146 (≠ I147), G147 (= G148), G149 (= G150), I151 (≠ L152), E170 (= E171), T171 (≠ F172), R178 (≠ V179), G229 (≠ S235), I230 (≠ A236), G231 (= G237)
- binding flavin-adenine dinucleotide: G11 (= G9), A13 (≠ V11), D35 (≠ E34), E36 (= E35), R43 (= R42), P44 (≠ V43), K48 (vs. gap), T76 (≠ N75), A77 (= A76), T104 (= T105), G105 (= G106), R125 (= R126), I151 (≠ L152), G267 (= G275), D268 (≠ E276)
Sites not aligning to the query:
1f3pA Ferredoxin reductase (bpha4)-nadh complex (see paper)
33% identity, 32% coverage: 3:277/849 of query aligns to 6:270/401 of 1f3pA
- active site: L13 (≠ M10), R44 (= R42), P45 (≠ V43)
- binding flavin-adenine dinucleotide: A14 (≠ V11), V34 (≠ L32), D36 (≠ E34), E37 (= E35), R44 (= R42), P45 (≠ V43), A78 (= A76), T105 (= T105), G106 (= G106), R126 (= R126), G268 (= G275), D269 (≠ E276)
- binding nicotinamide-adenine-dinucleotide: V147 (≠ I147), G148 (= G148), G150 (= G150), V151 (≠ L151), I152 (≠ L152), E155 (= E155), E171 (= E171), T172 (≠ F172), R179 (≠ V179), G230 (≠ S235), I231 (≠ A236), G232 (= G237), V233 (≠ I238)
Sites not aligning to the query:
Query Sequence
>RR42_RS31785 FitnessBrowser__Cup4G11:RR42_RS31785
MKLIIIGHGMVGHKFLECLAEAGSQDLEVTVLCEEPRPAYDRVHLSEFFAGKSAEDLSLV
EAGFFERSNMLLRLNARATGIDRAAKTVTVSTGETLSYDKLIMATGSYPFVPPLPGKDRK
DCFVYRTIEDLEAMQECGARSRTGVVIGGGLLGLECAKALRDMGLQTHVVEFAPRLMAVQ
VDDGGGAMLRRKIEELGVTAHTRKNTVEIVDGEDGTHRMNFADGSHLDTDMIVFSAGIRP
RDELARASGLAIGERGGIAVDNQCLSSDPDVYAIGECALWDGKIYGLVAPGYEMARVAAK
HLLGHRAEFAGADMSTKLKLMGVDVASLGDPHGNAPGSRSFQFTDERKQVYKKLVVSECG
KYLLGGVLVGDAEEYGTLLQMMLNKIELPESPEFLILPSSDGQAKPGLGADALPDSAQIC
SCNNVTKGDICAAVCSGTTNIGDMKRCTKAGSTCGGCVPLVTQVMKAEMKKQGLAVNNHL
CEHFAYSRQELYHLVRVGGFKTFGELLAAHGKGLGCDVCKPTVASILASCWNEFVLKQEH
ASLQDSNDYFLGNIQKDGTYSVVPRMPGGEVTPDGLIAVGQVAKKYGLYTKITGGARVDM
FGARVEELPMIWEELIAAGFESGHAYGKSLRTVKSCVGSTWCRYGVDDSVGLAIEIENRY
KGLRAPHKIKFGVSGCTRECAEAQGKDVGIIATERGWNLYVCGNGGMKPRHAELLASDLD
RATLLRYVDRFLMFYVRTADRLQRTSVWRDNMEGGLDYLKAVVLDDSLGIGAELEAQMQH
VVDTYEDEWKAAVTNPETRKRFRHFVNSDLRDDNLVFMEERGQIRPATPEERNLRKSRLE
QIPVIVKAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory