SitesBLAST
Comparing RR42_RS31820 FitnessBrowser__Cup4G11:RR42_RS31820 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
40% identity, 98% coverage: 7:261/261 of query aligns to 2:255/255 of 5itvA
- active site: G18 (= G23), S141 (= S149), Y154 (= Y162), K158 (= K166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G19), S17 (≠ R22), G18 (= G23), I19 (= I24), D38 (= D43), I39 (≠ L44), T61 (≠ L68), I63 (≠ V70), N89 (= N96), G91 (= G98), T139 (≠ V147), S141 (= S149), Y154 (= Y162), K158 (= K166), P184 (= P192), G185 (= G193), I186 (≠ Y194), I187 (= I195)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
41% identity, 96% coverage: 10:260/261 of query aligns to 3:247/248 of 6ixmC
- active site: G16 (= G23), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), S15 (≠ R22), G16 (= G23), I17 (= I24), D36 (= D43), I37 (≠ L44), A61 (≠ L68), D62 (= D69), T63 (≠ V70), N89 (= N96), A90 (= A97), M140 (≠ V147), S142 (= S149), Y155 (= Y162), K159 (= K166), P185 (= P192), A186 (≠ G193), Y187 (= Y194), I188 (= I195), L192 (≠ M199)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
44% identity, 95% coverage: 10:257/261 of query aligns to 5:241/244 of 4nbuB
- active site: G18 (= G23), N111 (= N121), S139 (= S149), Q149 (≠ V159), Y152 (= Y162), K156 (= K166)
- binding acetoacetyl-coenzyme a: D93 (≠ N103), K98 (≠ E108), S139 (= S149), N146 (≠ G156), V147 (≠ P157), Q149 (≠ V159), Y152 (= Y162), F184 (≠ Y194), M189 (= M199), K200 (≠ Y216)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G19), N17 (≠ R22), G18 (= G23), I19 (= I24), D38 (= D43), F39 (≠ L44), V59 (≠ L68), D60 (= D69), V61 (= V70), N87 (= N96), A88 (= A97), G89 (= G98), I90 (= I99), T137 (≠ V147), S139 (= S149), Y152 (= Y162), K156 (= K166), P182 (= P192), F184 (≠ Y194), T185 (≠ I195), T187 (= T197), M189 (= M199)
1zk1A Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
40% identity, 97% coverage: 10:261/261 of query aligns to 4:251/251 of 1zk1A
- active site: G17 (= G23), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding 1-phenylethanone: A93 (≠ G101), N95 (= N103), Y155 (= Y162), Y189 (= Y194)
- binding nicotinamide-adenine-dinucleotide: G13 (= G19), L16 (≠ R22), I18 (= I24), D37 (= D43), H61 (≠ L68), D62 (= D69), S63 (≠ V70), N89 (= N96), A90 (= A97), I92 (= I99), M140 (≠ V147), Y155 (= Y162), G188 (= G193), I190 (= I195), L194 (≠ M199)
1zjzA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
40% identity, 97% coverage: 10:261/261 of query aligns to 4:251/251 of 1zjzA
- active site: G17 (= G23), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding nicotinamide-adenine-dinucleotide: G13 (= G19), L16 (≠ R22), I18 (= I24), D37 (= D43), D62 (= D69), N89 (= N96), A90 (= A97), G91 (= G98), I92 (= I99), Y155 (= Y162), G188 (= G193), I190 (= I195), L194 (≠ M199)
- binding (1r)-1-phenylethanol: A93 (≠ G101), N95 (= N103), L152 (≠ V159), Y155 (= Y162)
1zjyA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh (see paper)
40% identity, 97% coverage: 10:261/261 of query aligns to 4:251/251 of 1zjyA
- active site: G17 (= G23), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G19), L16 (≠ R22), G17 (= G23), I18 (= I24), D37 (= D43), D62 (= D69), N89 (= N96), A90 (= A97), G91 (= G98), I92 (= I99), Y155 (= Y162), G188 (= G193), I190 (= I195), L194 (≠ M199)
- binding (1r)-1-phenylethanol: A93 (≠ G101), N95 (= N103), L152 (≠ V159), Y155 (= Y162), Y189 (= Y194)
1zk4A Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and NADP (see paper)
40% identity, 97% coverage: 10:261/261 of query aligns to 4:251/251 of 1zk4A
- active site: G17 (= G23), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding 1-phenylethanone: A93 (≠ G101), Y155 (= Y162), Y189 (= Y194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G19), T15 (≠ A21), L16 (≠ R22), I18 (= I24), T36 (≠ L42), G37 (≠ D43), R38 (≠ L44), H61 (≠ L68), D62 (= D69), N89 (= N96), A90 (= A97), G91 (= G98), I92 (= I99), Y155 (= Y162), G188 (= G193), I190 (= I195), T192 (= T197), L194 (≠ M199)
6y0sAAA R-specific alcohol dehydrogenase (see paper)
40% identity, 97% coverage: 10:261/261 of query aligns to 4:251/251 of 6y0sAAA
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
39% identity, 97% coverage: 10:261/261 of query aligns to 5:252/252 of Q6WVP7
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
39% identity, 97% coverage: 10:261/261 of query aligns to 4:251/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S149), I143 (≠ M150), Y155 (= Y162), F205 (≠ A215)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G19), T15 (≠ A21), L16 (≠ R22), G17 (= G23), I18 (= I24), R38 (≠ L44), H39 (≠ L45), D62 (= D69), A63 (≠ V70), N89 (= N96), A90 (= A97), V112 (= V120), M140 (≠ V147), S142 (= S149), Y155 (= Y162), K159 (= K166), P187 (= P192), P189 (≠ Y194), I190 (= I195), T192 (= T197), P193 (= P198), L194 (≠ M199)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
39% identity, 97% coverage: 10:261/261 of query aligns to 6:253/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S149), I145 (≠ M150), E146 (≠ Y151), Y157 (= Y162), V197 (≠ L200), F207 (≠ A215)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G19), T17 (≠ A21), I20 (= I24), R40 (≠ L44), H41 (≠ L45), D64 (= D69), A65 (≠ V70), N91 (= N96), A92 (= A97), V114 (= V120), M142 (≠ V147), S144 (= S149), Y157 (= Y162), K161 (= K166), P189 (= P192), G190 (= G193), P191 (≠ Y194), I192 (= I195), T194 (= T197), P195 (= P198), L196 (≠ M199)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 97% coverage: 10:261/261 of query aligns to 3:248/248 of 4urfB
- active site: G16 (= G23), S142 (= S149), I152 (≠ V159), Y155 (= Y162), K159 (= K166)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ M223), R211 (≠ G224), R212 (= R225)
- binding bicarbonate ion: I92 (= I99), G94 (= G101), R109 (= R116), R179 (= R186), S228 (= S241)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), G14 (≠ A21), N15 (≠ R22), G16 (= G23), I17 (= I24), D36 (= D43), I37 (≠ L44), D62 (= D69), T63 (≠ V70), N89 (= N96), A90 (= A97), G91 (= G98), I140 (≠ V147), Y155 (= Y162), K159 (= K166), P185 (= P192), A186 (≠ G193), I188 (= I195), T190 (= T197)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 97% coverage: 10:261/261 of query aligns to 3:248/248 of 4urfA
- active site: G16 (= G23), S142 (= S149), I152 (≠ V159), Y155 (= Y162), K159 (= K166)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I99), S93 (≠ D100), G94 (= G101), E95 (≠ V102), T97 (≠ A104), E101 (= E108), T103 (≠ A110), Q106 (= Q113), R109 (= R116), S175 (≠ G182), G177 (≠ N184)
- binding magnesium ion: S237 (≠ A250), Y238 (≠ E251)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), G14 (≠ A21), N15 (≠ R22), G16 (= G23), I17 (= I24), D36 (= D43), I37 (≠ L44), W41 (≠ D48), D62 (= D69), T63 (≠ V70), N89 (= N96), A90 (= A97), G91 (= G98), I140 (≠ V147), Y155 (= Y162), K159 (= K166), P185 (= P192), I188 (= I195), T190 (= T197)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 97% coverage: 10:261/261 of query aligns to 3:248/248 of 4ureB
- active site: G16 (= G23), S142 (= S149), I152 (≠ V159), Y155 (= Y162), K159 (= K166)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ R22), G16 (= G23), I17 (= I24), N89 (= N96), G91 (= G98), Y155 (= Y162), P185 (= P192), A186 (≠ G193)
2hsdA The refined three-dimensional structure of 3alpha,20beta- hydroxysteroid dehydrogenase and possible roles of the residues conserved in short-chain dehydrogenases (see paper)
43% identity, 97% coverage: 9:260/261 of query aligns to 2:243/253 of 2hsdA
- active site: G16 (= G23), S138 (= S149), Y151 (= Y162), K155 (= K166)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), R15 (= R22), G16 (= G23), L17 (≠ I24), D36 (= D43), V37 (≠ L44), L58 (= L68), V60 (= V70), N86 (= N96), A87 (= A97), S138 (= S149), Y151 (= Y162), K155 (= K166), P181 (= P192), G182 (= G193), T184 (≠ I195)
1hdcA Mechanism of inhibition of 3alpha,20beta-hydroxysteroid dehydrogenase by a licorice-derived steroidal inhibitor (see paper)
43% identity, 97% coverage: 9:260/261 of query aligns to 2:243/253 of 1hdcA
- active site: G16 (= G23), S138 (= S149), Y151 (= Y162), K155 (= K166)
- binding carbenoxolone: S90 (≠ D100), T91 (vs. gap), G92 (= G101), L147 (≠ D158), Y151 (= Y162), M183 (≠ Y194), M188 (= M199), T189 (≠ L200), T192 (≠ V203)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
39% identity, 96% coverage: 10:260/261 of query aligns to 4:239/244 of 1nfqA
- active site: G17 (= G23), S139 (= S149), Y152 (= Y162), K156 (= K166)
- binding Androsterone: L91 (≠ D100), E141 (≠ Y151), C149 (≠ V159), Y152 (= Y162), V193 (= V203), I197 (≠ L213), F198 (= F214)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (= R22), G17 (= G23), M18 (≠ I24), D37 (= D43), L39 (= L45), L59 (= L68), D60 (= D69), V61 (= V70), N87 (= N96), A88 (= A97), I137 (≠ V147), S139 (= S149), Y152 (= Y162), K156 (= K166), P182 (= P192), V185 (≠ I195), T187 (= T197), P188 (= P198), M189 (= M199), T190 (≠ L200)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
39% identity, 96% coverage: 10:260/261 of query aligns to 4:239/244 of 1nffA
- active site: G17 (= G23), S139 (= S149), Y152 (= Y162), K156 (= K166)
- binding nicotinamide-adenine-dinucleotide: G13 (= G19), R16 (= R22), G17 (= G23), M18 (≠ I24), D37 (= D43), I38 (≠ L44), L39 (= L45), L59 (= L68), D60 (= D69), V61 (= V70), N87 (= N96), A88 (= A97), G89 (= G98), I90 (= I99), I137 (≠ V147), S139 (= S149), Y152 (= Y162), K156 (= K166), P182 (= P192), V185 (≠ I195), T187 (= T197), P188 (= P198), M189 (= M199), T190 (≠ L200)
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 96% coverage: 10:260/261 of query aligns to 5:240/260 of P9WGT1
- I6 (≠ R11) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ RGI 22:24) binding
- D38 (= D43) binding
- V47 (≠ A52) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (= DV 69:70) binding
- T69 (≠ G77) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (= N96) binding
- S140 (= S149) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y162) binding ; mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K166) binding
- 183:191 (vs. 192:200, 56% identical) binding
5h5xC Crystal structure of nadh bound carbonyl reductase from streptomyces coelicolor
42% identity, 97% coverage: 9:260/261 of query aligns to 10:256/257 of 5h5xC
- active site: G24 (= G23), S151 (= S149), Y164 (= Y162), K168 (= K166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G19), S23 (≠ R22), G24 (= G23), I25 (= I24), D44 (= D43), F45 (≠ L44), L69 (= L68), D70 (= D69), N97 (= N96), A98 (= A97), Y164 (= Y162), K168 (= K166), P194 (= P192), G195 (= G193), I197 (= I195), T199 (= T197)
Query Sequence
>RR42_RS31820 FitnessBrowser__Cup4G11:RR42_RS31820
MEYPFNLFDLRGKVAAITGAARGIGAETARVLAAAGAKVAVLDLLEADGQAAVRRIEAEG
GQAAFWKLDVSSEAEVGKVFGEIAARFGRLDILINNAGIDGVNAPTHELALAQWQRVMDV
NVTGTFLCTKHAIAHLERAGGGSIVNVSSMYGIVGGPDVPPYHASKAAVRMMAKTDAMLY
AGKNIRANSVHPGYIRTPMLEEVAHASGQGEGLFAYLGAQAPMGRLGEPRDIAAGILYLV
SDAARYVTGAELVIDGGYTAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory