SitesBLAST
Comparing RR42_RS31825 FitnessBrowser__Cup4G11:RR42_RS31825 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P47229 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; 2,6-dioxo-6-phenylhexa-3-enoate hydrolase; EC 3.7.1.8 from Paraburkholderia xenovorans (strain LB400) (see paper)
37% identity, 90% coverage: 21:274/282 of query aligns to 23:283/286 of P47229
- S112 (= S110) mutation to A: Catalyzes the tautomerisation of HOPDA. Extremely low hydrolase activity; when associated with A-265.
- H265 (= H256) mutation to A: Unable to catalyze the tautomerisation of HOPDA. Extremely low hydrolase activity; when associated with A-112.
2og1A Crystal structure of bphd, a c-c hydrolase from burkholderia xenovorans lb400 (see paper)
37% identity, 90% coverage: 21:274/282 of query aligns to 22:282/285 of 2og1A
- active site: G41 (≠ S40), G42 (= G41), G44 (= G43), N110 (= N109), S111 (= S110), M112 (≠ L111), L155 (≠ M153), R189 (= R189), A207 (≠ T203), D236 (= D228), H264 (= H256), W265 (= W257)
- binding glycerol: Y52 (≠ K51), E184 (≠ A184)
2rhwA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3,10-di-fluoro hopda (see paper)
36% identity, 90% coverage: 21:274/282 of query aligns to 20:280/283 of 2rhwA
- active site: G39 (≠ S40), G40 (= G41), G42 (= G43), N108 (= N109), A109 (≠ S110), M110 (≠ L111), R187 (= R189), D234 (= D228), H262 (= H256), W263 (= W257)
- binding 3-fluoro-6-(4-fluorophenyl)-2-hydroxy-6-oxohexa-2,4-dienoic acid: G38 (= G39), G39 (≠ S40), G40 (= G41), A109 (≠ S110), M110 (≠ L111), G135 (= G136), I150 (= I150), F172 (≠ L174), L210 (vs. gap), F236 (= F230), V237 (≠ N231), H262 (= H256)
2rhtA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3-cl hopda (see paper)
36% identity, 90% coverage: 21:274/282 of query aligns to 20:280/283 of 2rhtA
- active site: G39 (≠ S40), G40 (= G41), G42 (= G43), N108 (= N109), A109 (≠ S110), M110 (≠ L111), R187 (= R189), D234 (= D228), H262 (= H256), W263 (= W257)
- binding (2Z,4E)-3-chloro-2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoic acid: G38 (= G39), G39 (≠ S40), G40 (= G41), A109 (≠ S110), M110 (≠ L111), I150 (= I150), L153 (≠ M153), F172 (≠ L174), R187 (= R189), F236 (= F230), V237 (≠ N231), H262 (= H256)
2puhA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with its substrate hopda (see paper)
36% identity, 90% coverage: 21:274/282 of query aligns to 20:280/283 of 2puhA
- active site: G39 (≠ S40), G40 (= G41), G42 (= G43), N108 (= N109), A109 (≠ S110), M110 (≠ L111), R187 (= R189), D234 (= D228), H262 (= H256), W263 (= W257)
- binding (3e)-2,6-dioxo-6-phenylhex-3-enoate: G38 (= G39), G39 (≠ S40), G40 (= G41), N108 (= N109), A109 (≠ S110), M110 (≠ L111), I150 (= I150), F172 (≠ L174), R187 (= R189), L210 (vs. gap), W213 (vs. gap), V237 (≠ N231), H262 (= H256), W263 (= W257)
2pujA Crystal structure of the s112a/h265a double mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with its substrate hopda (see paper)
36% identity, 90% coverage: 21:274/282 of query aligns to 20:280/283 of 2pujA
- active site: G39 (≠ S40), G40 (= G41), G42 (= G43), N108 (= N109), A109 (≠ S110), M110 (≠ L111), R187 (= R189), D234 (= D228), A262 (≠ H256), W263 (= W257)
- binding (2e,4e)-2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoic acid: G38 (= G39), G39 (≠ S40), G40 (= G41), A109 (≠ S110), M110 (≠ L111), G135 (= G136), I150 (= I150), L153 (≠ M153), F172 (≠ L174), R187 (= R189), V237 (≠ N231)
P9WNH5 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase; 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; Meta-cleavage product hydrolase; MCP hydrolase; EC 3.7.1.17; EC 3.7.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 90% coverage: 21:274/282 of query aligns to 24:287/291 of P9WNH5
- S114 (= S110) mutation to A: Reduces the hydrolase activity.
5jzbA Crystal structure of hsad bound to 3,5-dichlorobenzene sulphonamide (see paper)
37% identity, 90% coverage: 21:274/282 of query aligns to 18:281/282 of 5jzbA
- active site: G39 (≠ S40), G40 (= G41), G42 (= G43), N107 (= N109), S108 (= S110), L109 (= L111), R186 (= R189), D235 (= D228), H263 (= H256), W264 (= W257)
- binding 3,5-dichlorobenzene-1-sulfonamide: G39 (≠ S40), G40 (= G41), S108 (= S110), L109 (= L111), G134 (= G136), L152 (≠ M153), N238 (= N231)
7zm4A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclipostin-like inhibitor cyc31 (see paper)
37% identity, 90% coverage: 21:274/282 of query aligns to 18:281/284 of 7zm4A
7zm3A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclipostin-like inhibitor cyc17 (see paper)
37% identity, 90% coverage: 21:274/282 of query aligns to 18:281/284 of 7zm3A
7zm2A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclophostin-like inhibitor cyc8b (see paper)
37% identity, 90% coverage: 21:274/282 of query aligns to 18:281/284 of 7zm2A
7zm1A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclophostin-like inhibitor cyc7b (see paper)
37% identity, 90% coverage: 21:274/282 of query aligns to 18:281/284 of 7zm1A
5jzsB Hsad bound to 3,5-dichloro-4-hydroxybenzoic acid (see paper)
37% identity, 90% coverage: 21:274/282 of query aligns to 18:281/284 of 5jzsB
- active site: G39 (≠ S40), G40 (= G41), G42 (= G43), N107 (= N109), S108 (= S110), L109 (= L111), R186 (= R189), D235 (= D228), H263 (= H256), W264 (= W257)
- binding 3,5-dichloro-4-hydroxybenzoic acid: G39 (≠ S40), S108 (= S110), G148 (= G149), V149 (≠ I150), L152 (≠ M153), V237 (≠ F230)
5jz9A Crystal structure of hsad bound to 3,5-dichloro-4- hydroxybenzenesulphonic acid (see paper)
37% identity, 90% coverage: 21:274/282 of query aligns to 18:281/284 of 5jz9A
- active site: G39 (≠ S40), G40 (= G41), G42 (= G43), N107 (= N109), S108 (= S110), L109 (= L111), R186 (= R189), D235 (= D228), H263 (= H256), W264 (= W257)
- binding 3,5-dichloro-4-hydroxybenzene-1-sulfonic acid: G38 (= G39), G39 (≠ S40), G40 (= G41), S108 (= S110), G148 (= G149), L152 (≠ M153), F167 (≠ L170), M171 (≠ L174), V237 (≠ F230), H263 (= H256), W264 (= W257)
2wufB Crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with 4,9dsha (see paper)
36% identity, 90% coverage: 21:274/282 of query aligns to 18:281/282 of 2wufB
- active site: G39 (≠ S40), G40 (= G41), G42 (= G43), N107 (= N109), A108 (≠ S110), L109 (= L111), R186 (= R189), D235 (= D228), H263 (= H256), W264 (= W257)
- binding (3e,5r)-8-[(1s,3ar,4r,7as)-1-hydroxy-7a-methyl-5-oxooctahydro-1h-inden-4-yl]-5-methyl-2,6-dioxooct-3-enoate: G38 (= G39), G39 (≠ S40), G40 (= G41), A108 (≠ S110), L109 (= L111), L152 (≠ M153), F206 (vs. gap), H263 (= H256), W264 (= W257)
2wueB Crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with hopoda (see paper)
36% identity, 90% coverage: 21:274/282 of query aligns to 18:281/282 of 2wueB
- active site: G39 (≠ S40), G40 (= G41), G42 (= G43), N107 (= N109), A108 (≠ S110), L109 (= L111), R186 (= R189), D235 (= D228), H263 (= H256), W264 (= W257)
- binding (3e,5r)-8-(2-chlorophenyl)-5-methyl-2,6-dioxooct-3-enoate: G38 (= G39), G39 (≠ S40), G40 (= G41), A108 (≠ S110), L109 (= L111), V149 (≠ I150), L152 (≠ M153), M202 (≠ V206), F206 (vs. gap), V237 (≠ F230), H263 (= H256)
2wugA Crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with hopda (see paper)
36% identity, 90% coverage: 21:274/282 of query aligns to 18:281/283 of 2wugA
- active site: G39 (≠ S40), G40 (= G41), G42 (= G43), N107 (= N109), A108 (≠ S110), L109 (= L111), R186 (= R189), D235 (= D228), H263 (= H256), W264 (= W257)
- binding (3e)-2,6-dioxo-6-phenylhex-3-enoate: G38 (= G39), G39 (≠ S40), G40 (= G41), A108 (≠ S110), L109 (= L111), M202 (≠ V206), H263 (= H256), W264 (= W257)
P77044 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase; 2-hydroxy-6-ketonona-2,4-diene-1,9-dioic acid 5,6-hydrolase; 2-hydroxy-6-oxonona-2,4,7-triene-1,9-dioic acid 5,6-hydrolase; 2-hydroxy-6-oxonona-2,4-diene-1,9-dioic acid 5,6-hydrolase; EC 3.7.1.14 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 90% coverage: 21:275/282 of query aligns to 24:286/288 of P77044
- S44 (= S40) mutation to A: 2-fold decrease in catalytic efficiency and more than 5-fold increase in affinity for the natural substrate.
- N113 (= N109) mutation to A: 200-fold decrease in catalytic activity and almost 2-fold increase in affinity.; mutation to H: 350-fold decrease in catalytic activity and almost 2-fold increase in affinity.
- S114 (= S110) Transition state stabilizer; mutation to A: Weakly active. 3-fold decrease in affinity. Fast ketonisation and slow C-C cleavage.; mutation to G: Weakly active. 3-fold decrease in affinity. Fast ketonisation and slow C-C cleavage.
- H118 (≠ A114) mutation to A: More than 2-fold decrease in catalytic efficiency and 3-fold increase affinity.
- F177 (≠ L174) mutation to D: 100-fold decrease in catalytic activity.; mutation to G: 4-fold and 8-fold decrease in catalytic activity and affinity, respectively.
- R192 (= R189) Catalytic role in ketonization of the dienol substrate (substrate destabilization); mutation to K: 40-fold and 5-fold decrease in catalytic activity and affinity, respectively.; mutation to Q: 280-fold and 10-fold decrease in catalytic activity and affinity, respectively.
- C265 (= C254) mutation to A: 2-fold decrease in catalytic activity and almost 2-fold increase in affinity.
- H267 (= H256) active site, Proton acceptor; mutation to A: Weakly active, 1000-fold decrease in catalytic efficiency. Very slow ketonisation and C-C cleavage.
- W268 (= W257) mutation to G: 10-fold and 20-fold decrease in catalytic activity and affinity, respectively.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1iunB Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal (see paper)
30% identity, 96% coverage: 7:276/282 of query aligns to 1:271/276 of 1iunB
- active site: S33 (= S40), G34 (= G41), G36 (= G43), N101 (= N109), A102 (≠ S110), F103 (≠ L111), G126 (≠ A134), V141 (≠ L156), R173 (= R189), F186 (≠ L201), D223 (= D228), H251 (= H256), W252 (= W257)
- binding acetate ion: H244 (≠ V249), R260 (≠ Y265)
2d0dA Crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant (see paper)
30% identity, 95% coverage: 9:276/282 of query aligns to 2:270/271 of 2d0dA
- active site: S32 (= S40), G33 (= G41), G35 (= G43), N100 (= N109), S101 (= S110), F102 (≠ L111), G125 (≠ A134), V140 (≠ L156), R172 (= R189), F185 (≠ L201), D222 (= D228), H250 (= H256), W251 (= W257)
- binding chloride ion: S32 (= S40), S101 (= S110), F102 (≠ L111)
Query Sequence
>RR42_RS31825 FitnessBrowser__Cup4G11:RR42_RS31825
MSSTSPAALPAGQTITTPDGLRLHYLDAGAGEPVVFIHGSGPGASGHSNFKHNAPAFAAA
GFRTVVVDLPGYGQSSKPADVEYTLDFFVAALRAQLLALALPRCVLVGNSLGGAIALKYA
LDYPEHVSRLVMMAPGGVEDRETYFRMEGIEKMVSLFTGGHMNPDTMRQLLTLLVHDATL
VTDALVDERMAVCKAQPREVLATMKVPNLTERLGEIACPVLGFWGTEDRFNPAGGALKFL
QGCRDARFVLINRCGHWVMVEHSDYFNRECLGFLADTAEAAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory