Comparing RR42_RS31950 FitnessBrowser__Cup4G11:RR42_RS31950 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
Q0S7Q0 Cholesterol ring-cleaving hydrolase IpdB subunit; (3E)-2-(2-carboxylatoethyl)-3-methyl-6-oxocyclohex-1-ene-1-carboxyl-CoA hydrolase beta subunit; COCHEA-CoA hydrolase beta subunit; EC 4.1.99.- from Rhodococcus jostii (strain RHA1) (see paper)
40% identity, 95% coverage: 1:254/267 of query aligns to 1:247/253 of Q0S7Q0
6cojB Crystal structure of rhodococcus jostii rha1 ipdab e105a cochea-coa complex (see paper)
40% identity, 93% coverage: 6:254/267 of query aligns to 2:242/248 of 6cojB
>RR42_RS31950 FitnessBrowser__Cup4G11:RR42_RS31950
MSATQQFTLAELMIAAAARAWRDDGEVMATGIGTGPRIAAGLARLLHNPGLMLTDGEAYL
VEEPVPLGRREPGFKVRASGWMGYARVFDCLWGGRRHALVMPTQIDRFGQANISMLGGTH
AQPKKQLLGARGFPGNSIHHANSFFVPAHSPRAFVAGEVDMVCSVGYNPARQIEGMRSFV
DLRVIVTDLCVMDFTGPDHAIRVRSLHPGVSLEQVRAATGFALANPSGEILPQTPAPTAD
ELAVIGRLDPHNLRAAIVRENPAVRAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory