Comparing RR42_RS31960 FitnessBrowser__Cup4G11:RR42_RS31960 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WNW7 Iron-dependent extradiol dioxygenase; EC 1.13.11.25 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
47% identity, 100% coverage: 2:298/298 of query aligns to 1:299/300 of P9WNW7
2zi8A Crystal structure of the hsac extradiol dioxygenase from m. Tuberculosis in complex with 3,4-dihydroxy-9,10-seconandrost-1,3, 5(10)-triene-9,17-dione (dhsa) (see paper)
47% identity, 100% coverage: 2:298/298 of query aligns to 1:299/299 of 2zi8A
6l3wA Crystal structure of bphc, a halotolerant catechol dioxygenase (see paper)
36% identity, 97% coverage: 4:291/298 of query aligns to 4:283/298 of 6l3wA
1knfA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase complexed with 3-methyl catechol under anaerobic condition (see paper)
35% identity, 97% coverage: 4:291/298 of query aligns to 2:284/288 of 1knfA
1kndA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase complexed with catechol under anaerobic condition (see paper)
35% identity, 97% coverage: 4:291/298 of query aligns to 2:284/288 of 1kndA
1kmyA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase complexed with 2,3-dihydroxybiphenyl under anaerobic condition (see paper)
35% identity, 97% coverage: 4:291/298 of query aligns to 2:284/288 of 1kmyA
1lkdA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase (dhbd) complexed with 2',6'-dicl dihydroxybiphenyl (dhb) (see paper)
35% identity, 97% coverage: 4:291/298 of query aligns to 2:284/287 of 1lkdA
1lgtA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase (dhbd) complexed with 2'-cl dihydroxybiphenyl (dhb) (see paper)
35% identity, 97% coverage: 4:291/298 of query aligns to 2:284/287 of 1lgtA
1hanA Crystal structure of the biphenyl-cleaving extradiol dioxygenase from a pcb-degrading pseudomonad (see paper)
35% identity, 97% coverage: 4:291/298 of query aligns to 2:284/287 of 1hanA
Sites not aligning to the query:
1kw8B Crystal structure of bphc-2,3-dihydroxybiphenyl-no complex (see paper)
35% identity, 97% coverage: 4:291/298 of query aligns to 2:285/288 of 1kw8B
1kw3B Crystal structure of 2,3-dihydroxybiphenyal dioxygenase (bphc) at 1.45 a resolution (see paper)
35% identity, 97% coverage: 4:291/298 of query aligns to 2:285/288 of 1kw3B
1eirA 2,3-dihydroxybiphenyl-1,2-dioxygenase (see paper)
35% identity, 97% coverage: 4:291/298 of query aligns to 2:285/289 of 1eirA
1eilA 2,3-dihydroxybiphenyl-1,2-dioxygenase (see paper)
35% identity, 97% coverage: 4:291/298 of query aligns to 2:285/289 of 1eilA
3vb0A Crystal structure of 2,2',3-trihydroxybiphenyl 1,2-dioxygenase from dibenzofuran-degrading sphingomonas wittichii strain rw1
33% identity, 98% coverage: 4:294/298 of query aligns to 2:289/289 of 3vb0A
2wl9A Crystal structure of catechol 2,3-dioxygenase (see paper)
29% identity, 90% coverage: 1:269/298 of query aligns to 1:267/300 of 2wl9A
2wl3A Crystal structure of catechol 2,3-dioxygenase (see paper)
29% identity, 89% coverage: 4:269/298 of query aligns to 3:266/287 of 2wl3A
2wl9B Crystal structure of catechol 2,3-dioxygenase (see paper)
28% identity, 89% coverage: 4:269/298 of query aligns to 3:261/293 of 2wl9B
2ei0A Anaerobic crystal structure analysis of 1,2-dihydroxynaphthalene dioxygenase from pseudomonas sp. Strain c18 complexed with 3,4- dihydroxybiphenyl
28% identity, 89% coverage: 7:270/298 of query aligns to 6:262/286 of 2ei0A
Sites not aligning to the query:
2ei1A Anaerobic crystal structure analysis of the 1,2-dihydroxynaphthalene dioxygeanse of pseudomonas sp. Strain c18 complexes to 1,2- dihydroxynaphthalene
28% identity, 89% coverage: 7:270/298 of query aligns to 6:262/293 of 2ei1A
2ei3A Anaerobic crystal structure analysis of the 1,2-dihydroxynaphthalene dioxygenase from pseudomonas sp. Strain c18 complexes with 2,3- dihydroxybiphenyl
28% identity, 89% coverage: 7:270/298 of query aligns to 6:267/298 of 2ei3A
Sites not aligning to the query:
>RR42_RS31960 FitnessBrowser__Cup4G11:RR42_RS31960
MMDIRALGYIVVESTDTERWRHYGEQVLGMACTNAPHGALYLKMDERDYRYLIVPGKQDR
YLASGWELAGEAAFNHALATLRAANVEVTHASEAERIQRRAQAVAWFADPSGNRHEIFWG
MRSDFLRFVSPIGVSCFVTDPLGAGHSVLPAPAFDETYAFLRDVMGFGLSDIFRARFTTD
PAEPEKRIHFLHCGNGRHHSLAIFEAPAPSGCVHVMAEVPDMGEVGRALDRAQQHGVALS
ATLGQHCNDRIVSFYMKTPGGFDLEYGYGGLVVDWSQHAAFEATRVSLWGHDFSIGYR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory